Basic Vector Information
- Vector Name:
- pJM1
- Antibiotic Resistance:
- Tetracycline
- Length:
- 3780 bp
- Type:
- Gateway entry vector
- Replication origin:
- ori
- Source/Author:
- Rozwadowski K, Yang W, Kagale S.
- Promoter:
- tet
pJM1 vector Vector Map
pJM1 vector Sequence
LOCUS 40924_26271 3780 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway entry vector pJM1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3780) AUTHORS Rozwadowski K, Yang W, Kagale S. TITLE Homologous recombination-mediated cloning and manipulation of genomic DNA regions using Gateway and recombineering systems JOURNAL BMC Biotechnol. 8, 88 (2008) PUBMED 19014699 REFERENCE 2 (bases 1 to 3780) AUTHORS Rozwadowski KL, Yang W, Kagale S. TITLE Direct Submission JOURNAL Submitted (16-OCT-2008) Molecular Genetics, Agriculture and Agri-Food Canada, 107 Science Place, Saskatoon, Saskatchewan S7N 0X2, Canada REFERENCE 3 (bases 1 to 3780) TITLE Direct Submission REFERENCE 4 (bases 1 to 3780) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Biotechnol. 8, 88 (2008)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-OCT-2008) Molecular Genetics, Agriculture and Agri-Food Canada, 107 Science Place, Saskatoon, Saskatchewan S7N 0X2, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3780 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 103..189 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 281..308 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" protein_bind 358..457 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS 613..915 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(947..1046) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter 1133..1161 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 1209..2396 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" rep_origin 3130..3718 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.