Basic Vector Information
- Vector Name:
- pJLO19
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8525 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Lo J, Zheng T, Hon S, Olson DG, Lynd LR.
pJLO19 vector Map
pJLO19 vector Sequence
LOCUS V005306 8525 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005306 VERSION V005306 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8525) AUTHORS Lo J, Zheng T, Hon S, Olson DG, Lynd LR. TITLE The bifunctional alcohol and aldehyde dehydrogenase gene, adhE, is necessary for ethanol production in Clostridium thermocellum and Thermoanaerobacterium saccharolyticum JOURNAL J. Bacteriol. (2015) In press PUBMED 25666131 REFERENCE 2 (bases 1 to 8525) AUTHORS Lo J, Zheng T, Hon S, Olson DG, Lynd LR. TITLE Direct Submission JOURNAL Submitted (12-JAN-2015) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 8525) TITLE Direct Submission REFERENCE 4 (bases 1 to 8525) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "J. Bacteriol. (2015) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-JAN-2015) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8525 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(561..1418) /label="AmpR" /note="beta-lactamase" promoter complement(1419..1523) /label="AmpR promoter" CDS 3192..3839 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 3860..4405 /codon_start=1 /gene="hpt" /product="hpt" /EC_number="2.4.2.8" /label="hpt" /note="hypoxanthine phosphoribosyltransferase" /protein_id="AJO16025.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 3860..4405 /gene="hpt" /label="hpt" terminator 5123..5311 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(5571..6159) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6246..6824) /codon_start=1 /gene="tdk" /product="tdk" /EC_number="2.7.1.21" /label="tdk" /note="thymidine kinase" /protein_id="AJO16027.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(6246..6824) /gene="tdk" /label="tdk" CDS complement(7524..8525) /label="repB" /note="RepB replication protein"
This page is informational only.