Basic Vector Information
- Vector Name:
- pJL71-2W-gpmcherry
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7279 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Scharschmidt TC, Rosenblum MD.
pJL71-2W-gpmcherry vector Map
pJL71-2W-gpmcherry vector Sequence
LOCUS V005310 7279 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005310 VERSION V005310 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7279) AUTHORS Scharschmidt TC, Rosenblum MD. TITLE A wave of regulatory T cells into neonatal skin mediates tolerance to commensal microbes JOURNAL Unpublished REFERENCE 2 (bases 1 to 7279) AUTHORS Scharschmidt TC, Rosenblum MD. TITLE Direct Submission JOURNAL Submitted (30-OCT-2014) Dermatology, University of California San Francisco, 513 Parnassus Ave, San Francisco, CA 94143, USA REFERENCE 3 (bases 1 to 7279) TITLE Direct Submission REFERENCE 4 (bases 1 to 7279) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-OCT-2014) Dermatology, University of California San Francisco, 513 Parnassus Ave, San Francisco, CA 94143, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7279 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 7..306 /regulatory_class="terminator" CDS 2837..3568 /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" promoter 3936..4040 /label="AmpR promoter" CDS 4041..4898 /label="AmpR" /note="beta-lactamase" rep_origin 5072..5660 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5761..6165) /codon_start=1 /product="ArgB" /label="ArgB" /protein_id="AKT95053.1" /translation="MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIV MYTIAYILNIFLFTLITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHI NFLIMIILTVISLGVISVYAPSGRQLTQRR" regulatory 5792..6479 /gene="agr" /regulatory_class="promoter" gene 5792..6479 /gene="agr" /label="agr" regulatory complement(6193..6198) /gene="agr_P2" /regulatory_class="minus_10_signal" gene complement(6193..6198) /gene="agr_P2" /label="agr_P2" regulatory complement(6216..6221) /gene="agr-P2" /regulatory_class="minus_35_signal" gene complement(6216..6221) /gene="agr-P2" /label="agr-P2" gene 6389..6417 /gene="agr-P3" /label="agr-P3" regulatory 6389..6394 /gene="agr-P3" /regulatory_class="minus_35_signal" regulatory 6412..6417 /gene="agr-P3" /regulatory_class="minus_10_signal" CDS 6570..7274 /label="mCherry" /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)"
This page is informational only.