Basic Vector Information
- Vector Name:
- pJH391
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7044 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Marino-Ramirez L, Hu JC.
pJH391 vector Map
pJH391 vector Sequence
LOCUS 40924_26116 7044 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pJH391, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7044) AUTHORS Marino-Ramirez L, Hu JC. TITLE Using lambda repressor fusions to isolate and characterize self-assembling domains JOURNAL Unpublished REFERENCE 2 (bases 1 to 7044) AUTHORS Hu JC. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 7044) TITLE Direct Submission REFERENCE 4 (bases 1 to 7044) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-OCT-2000) Biochemistry " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7044 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 28..58 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" protein_bind 66..82 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." regulatory 91..94 /regulatory_class="ribosome_binding_site" CDS 103..531 /codon_start=1 /product="cI DNA binding domain" /label=cI DNA binding domain /note="cI-DBD" /protein_id="AAK07889.1" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPKLRTFTKGDAERWVSTDRSRRFTTS" CDS 2438..2503 /label=GCN4_v1 /note="GCN4 peptide that allows binding to an scFv-GFP fusion protein (Tanenbaum et al., 2014)" terminator 2573..2620 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS 4105..4293 /label=rop /note="Rop protein, which maintains plasmids at low copy number" misc_feature 4398..4538 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(4724..5312) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" rep_origin 5423..5936 /label=M13 ori /note="M13 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(5981..6838) /label=AmpR /note="beta-lactamase" promoter complement(6839..6943) /label=AmpR promoter
This page is informational only.