Basic Vector Information
- Vector Name:
- pJG098
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10777 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Goodson J, Klupt S, Zhang C, Straight P, Winkler W.
pJG098 vector Map
pJG098 vector Sequence
LOCUS V005336 10777 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005336 VERSION V005336 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10777) AUTHORS Goodson J, Klupt S, Zhang C, Straight P, Winkler W. TITLE A Broadly Conserved Antiterminator Protein Controls a Regulon of Bacillus amyloliquefaciens Antibiotic Gene Clusters JOURNAL Unpublished REFERENCE 2 (bases 1 to 10777) AUTHORS Goodson JR, Klupt SL. TITLE Direct Submission JOURNAL Submitted (01-JUL-2016) Cell Biology and Molecular Genetics, University of Maryland, 3112 Bioscience Research Building, College Park, MD 20742, USA REFERENCE 3 (bases 1 to 10777) TITLE Direct Submission REFERENCE 4 (bases 1 to 10777) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-JUL-2016) Cell Biology and Molecular Genetics, University of Maryland, 3112 Bioscience Research Building, College Park, MD 20742, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10777 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 3..107 /label="AmpR promoter" CDS 108..965 /label="AmpR" /note="beta-lactamase" rep_origin 1139..1727 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1977..2756) /gene="ant1" /label="Spectinomycin 9-adenylyltransferase" /note="Spectinomycin 9-adenylyltransferase from Staphylococcus aureus (strain N315). Accession#: P0A0D1" misc_feature 3865..4865 /pseudo="" /note="amyE; amyE back; amyE homology for integration into B. amyloliquefaciens" CDS complement(5239..5886) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory 6196..6337 /note="PdfnA; promoter region of dfnA from B. amyloliquefaciens FZB42" /regulatory_class="promoter" misc_feature 6345..6622 /note="dfnA leader region (truncated); dfnA leader region missing basepairs +76-198" terminator 6622..6669 /label="T7 terminator" /note="transcription terminator for bacteriophage T7 RNA polymerase" regulatory 6671..6716 /note="lambda tR2 terminator; transcription terminator tR2 from lambda phage" /regulatory_class="terminator" terminator complement(6720..6763) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" CDS 6789..7505 /label="mVenus" /note="Venus YFP with monomerizing A206K mutation (Nagai et al., 2002; Kremers et al., 2006)" CDS complement(7622..8152) /codon_start=1 /gene="loaP" /product="LoaP" /label="loaP" /note="LoaP; LoaP NusG-like antiterminator protein" /protein_id="APU90176.1" /translation="MKWYALFVESGKEETVQKFLRLQFDEQALYSIIPKKKVTERKAGI KYEALKKMFPGYVLFKTKMTERTFHKIKELPISCRIVNNGAYYSKERKTYFTTIKDEEI LPIIRLIGEGDTVDYSKVYIENSKVTVASGPLKGMEGIIKKIDKRKRRAKICLSFMGLD KMVNVGIEVLSKP" gene complement(7622..8152) /gene="loaP" /label="loaP" CDS complement(8181..8240) /codon_start=1 /gene="mini-xylA" /product="XylA fragment" /label="mini-xylA" /note="mini xylA ORF" /protein_id="APU90177.1" /translation="MAQSHSSSVNYFVSVNKVV" gene complement(8181..8240) /gene="mini-xylA" /label="mini-xylA" /note="xylA" regulatory complement(8310..8389) /note="PxylA; PxylA Xylose-Inducible Promoter" /regulatory_class="promoter" CDS 8601..9653 /codon_start=1 /gene="xylR" /product="XylR Xylose Repressor protein" /label="xylR" /note="XylR" /protein_id="APU90178.1" /translation="MTGLNKSTVSSQVNTLMKENLVFEIGQGQSSGGRRPVMLVFNKKA GYSIGIDVGVDYISGILTDLEGTIILDQHHHLESNSPEITKDILIDMIHHFITRMPQSP YGLIGIGICVPGLIDKNQKIVFTPNSNWRDIDLKSFIQEKFNVPVFIENEANAGAYGEK VFGAAKNHNNIIYASISTGIGIGVIINNHLYRGVSGFSGEMGHMTIDFNGPKCSCGNRG CWELYASEKALLKSLQTKEKKVSYQDIIDLAHLNDIGTLNALQNFGFYLGIGLTNILNT FNPQAIILRNSIIESHPMVLNSIRSEVSSRVYPQLGNSYELLPSSLGKNAPALGMSSIV IEHFLDIVKM" gene 8601..9653 /gene="xylR" /label="xylR" misc_feature 9661..10560 /pseudo="" /note="amyE; amyE front; amyE homology for integration into B. amyloliquefaciens"
This page is informational only.