Basic Vector Information
- Vector Name:
- pJG092
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10749 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Goodson J, Klupt S, Zhang C, Straight P, Winkler W.
pJG092 vector Map
pJG092 vector Sequence
LOCUS V005340 10749 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005340 VERSION V005340 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10749) AUTHORS Goodson J, Klupt S, Zhang C, Straight P, Winkler W. TITLE A Broadly Conserved Antiterminator Protein Controls a Regulon of Bacillus amyloliquefaciens Antibiotic Gene Clusters JOURNAL Unpublished REFERENCE 2 (bases 1 to 10749) AUTHORS Goodson JR, Klupt SL. TITLE Direct Submission JOURNAL Submitted (01-JUL-2016) Cell Biology and Molecular Genetics, University of Maryland, 3112 Bioscience Research Building, College Park, MD 20742, USA REFERENCE 3 (bases 1 to 10749) TITLE Direct Submission REFERENCE 4 (bases 1 to 10749) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-JUL-2016) Cell Biology and Molecular Genetics, University of Maryland, 3112 Bioscience Research Building, College Park, MD 20742, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10749 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 4..108 /label="AmpR promoter" CDS 109..966 /label="AmpR" /note="beta-lactamase" rep_origin 1140..1728 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1978..2757) /gene="ant1" /label="Spectinomycin 9-adenylyltransferase" /note="Spectinomycin 9-adenylyltransferase from Staphylococcus aureus (strain N315). Accession#: P0A0D1" misc_feature 3866..4866 /pseudo="" /note="amyE; amyE back; amyE homology for integration into B. amyloliquefaciens" CDS complement(5240..5887) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory 6197..6338 /note="PdfnA; promoter region of dfnA from B. amyloliquefaciens FZB42" /regulatory_class="promoter" 5'UTR 6346..6746 /note="dfnA leader region; dfnA leader region from B. amyloliquefaciens FZB42" CDS 6762..7478 /label="mVenus" /note="Venus YFP with monomerizing A206K mutation (Nagai et al., 2002; Kremers et al., 2006)" regulatory 7488..7521 /label="YFP_terminator" /note="YFP_terminator" /regulatory_class="terminator" CDS complement(7595..8125) /codon_start=1 /gene="loaP" /product="LoaP" /label="loaP" /note="LoaP; LoaP NusG-like antiterminator protein" /protein_id="APU90162.1" /translation="MKWYALFVESGKEETVQKFLRLQFDEQALYSIIPKKKVTERKAGI KYEALKKMFPGYVLFKTKMTERTFHKIKELPISCRIVNNGAYYSKERKTYFTTIKDEEI LPIIRLIGEGDTVDYSKVYIENSKVTVASGPLKGMEGIIKKIDKRKRRAKICLSFMGLD KMVNVGIEVLSKP" gene complement(7595..8125) /gene="loaP" /label="loaP" CDS complement(8154..8213) /codon_start=1 /gene="mini-xylA" /product="hypothetical protein" /label="mini-xylA" /note="mini xylA ORF" /protein_id="APU90163.1" /translation="MAQSHSSSVNYFVSVNKVV" gene complement(8154..8213) /gene="mini-xylA" /label="mini-xylA" /note="xylA" protein_bind complement(8283..8293) /label="XylR binding site" /bound_moiety="XylR" /note="xylO operator" protein_bind complement(8297..8307) /label="XylR binding site" /bound_moiety="XylR" /note="xylO operator" regulatory complement(8317..8322) /label="-10 (sigA)" /note="-10 (sigA)" /regulatory_class="minus_10_signal" regulatory complement(8340..8347) /label="-35 (sigA)" /note="-35 (sigA)" /regulatory_class="minus_35_signal" CDS 8574..9626 /codon_start=1 /gene="xylR" /product="XylR Xylose Repressor protein" /label="xylR" /note="XylR" /protein_id="APU90164.1" /translation="MTGLNKSTVSSQVNTLMKENLVFEIGQGQSSGGRRPVMLVFNKKA GYSIGIDVGVDYISGILTDLEGTIILDQHHHLESNSPEITKDILIDMIHHFITRMPQSP YGLIGIGICVPGLIDKNQKIVFTPNSNWRDIDLKSFIQEKFNVPVFIENEANAGAYGEK VFGAAKNHNNIIYASISTGIGIGVIINNHLYRGVSGFSGEMGHMTIDFNGPKCSCGNRG CWELYASEKALLKSLQTKEKKVSYQDIIDLAHLNDIGTLNALQNFGFYLGIGLTNILNT FNPQAIILRNSIIESHPMVLNSIRSEVSSRVYPQLGNSYELLPSSLGKNAPALGMSSIV IEHFLDIVKM" gene 8574..9626 /gene="xylR" /label="xylR" misc_feature 9634..10533 /pseudo="" /note="amyE; amyE front; amyE homology for integration into B. amyloliquefaciens"
This page is informational only.