Basic Vector Information
- Vector Name:
- pJG032
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9402 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Goodson J, Klupt S, Zhang C, Straight P, Winkler W.
pJG032 vector Vector Map
pJG032 vector Sequence
LOCUS V005342 9402 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005342 VERSION V005342 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9402) AUTHORS Goodson J, Klupt S, Zhang C, Straight P, Winkler W. TITLE A Broadly Conserved Antiterminator Protein Controls a Regulon of Bacillus amyloliquefaciens Antibiotic Gene Clusters JOURNAL Unpublished REFERENCE 2 (bases 1 to 9402) AUTHORS Goodson JR. TITLE Direct Submission JOURNAL Submitted (01-JUL-2016) Cell Biology and Molecular Genetics, University of Maryland, 3112 Bioscience Research Building, College Park, MD 20742, USA REFERENCE 3 (bases 1 to 9402) TITLE Direct Submission REFERENCE 4 (bases 1 to 9402) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-JUL-2016) Cell Biology and Molecular Genetics, University of Maryland, 3112 Bioscience Research Building, College Park, MD 20742, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9402 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..780 /gene="ant1" /label="Spectinomycin 9-adenylyltransferase" /note="Spectinomycin 9-adenylyltransferase from Staphylococcus aureus (strain N315). Accession#: P0A0D1" rep_origin complement(1030..1618) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1792..2649) /label="AmpR" /note="beta-lactamase" promoter complement(2650..2754) /label="AmpR promoter" misc_feature 2974..3873 /label="amyE front" /note="amyE front" CDS complement(3881..4933) /codon_start=1 /gene="xylR" /product="XylR Xylose Repressor protein" /label="xylR" /note="XylR" /protein_id="APU90152.1" /translation="MTGLNKSTVSSQVNTLMKENLVFEIGQGQSSGGRRPVMLVFNKKA GYSIGIDVGVDYISGILTDLEGTIILDQHHHLESNSPEITKDILIDMIHHFITRMPQSP YGLIGIGICVPGLIDKNQKIVFTPNSNWRDIDLKSFIQEKFNVPVFIENEANAGAYGEK VFGAAKNHNNIIYASISTGIGIGVIINNHLYRGVSGFSGEMGHMTIDFNGPKCSCGNRG CWELYASEKALLKSLQTKEKKVSYQDIIDLAHLNDIGTLNALQNFGFYLGIGLTNILNT FNPQAIILRNSIIESHPMVLNSIRSEVSSRVYPQLGNSYELLPSSLGKNAPALGMSSIV IEHFLDIVKM" gene complement(3881..4933) /gene="xylR" /label="xylR" regulatory 5160..5167 /label="-35 (sigA)" /note="-35 (sigA)" /regulatory_class="minus_35_signal" regulatory 5185..5190 /label="-10 (sigA)" /note="-10 (sigA)" /regulatory_class="minus_10_signal" protein_bind 5200..5210 /label="XylR binding site" /bound_moiety="XylR" /note="xylO operator" protein_bind 5214..5224 /label="XylR binding site" /bound_moiety="XylR" /note="xylO operator" CDS 5294..5353 /codon_start=1 /gene="xylA" /product="XylA fragment" /label="xylA" /note="mini xylA ORF" /protein_id="APU90153.1" /translation="MAQSHSSSVNYFVSVNKVV" gene 5294..5353 /gene="xylA" /label="xylA" CDS 5382..5912 /codon_start=1 /gene="loaP" /product="LoaP" /label="loaP" /protein_id="APU90154.1" /translation="MKWYALFVESGKEETVQKFLRLQFDEQALYSIIPKKKVTERKAGI KYEALKKMFPGYVLFKTKMTERTFHKIKELPISCRIVNNGAYYSKERKTYFTTIKDEEI LPIIRLIGEGDTVDYSKVYIENSKVTVASGPLKGMEGIIKKIDKRKRRAKICLSFMGLD KMVNVGIEVLSKP" gene 5382..5912 /gene="loaP" /label="loaP" CDS 6273..6920 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" misc_feature 7294..8294 /label="amyE back" /note="amyE back"
This page is informational only.