pJFR2 vector (V005348)

Download GeneBank File(.gb)

LOCUS       40924_26026        5846 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pJFR2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5846)
  AUTHORS   Fernandez-Rodriguez J, Moser F, Voigt CA.
  TITLE     Multichromatic Bacterial Photography
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5846)
  AUTHORS   Fernandez-Rodriguez J, Moser F, Voigt CA.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2016) Biological Engineering, MIT, 500 Tech 
            Square, Rm 140, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 5846)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5846)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (31-MAR-2016) Biological Engineering, MIT, 500 Tech Square, Rm 140, 
            Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5846
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      46..292
                     /label=Promoter FixK2
                     /note="Promoter FixK2"
                     /regulatory_class="promoter"
     CDS             326..928
                     /codon_start=1
                     /product="PhlF"
                     /label=PhlF
                     /protein_id="ARG47674.1"
                     /translation="MARTPSRSSIGSLRSPHTHKAILTSTIEILKECGYSGLSIESVAR
                     RAGASKPTIYRWWTNKAALIAEVYENESEQVRKFPDLGSFKADLDFLLRNLWKVWRETI
                     CGEAFRCVIAEAQLDPATLTQLKDQFMERRREMPKKLVENAISNGELPKDTNRELLLDM
                     IFGFCWYRLLTEQLTVEQDIEEFTFLLINGVCPGTQR"
     terminator      952..1023
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      1039..1066
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     misc_feature    1109..1138
                     /label=Operator PhlF
                     /note="Operator PhlF"
     misc_RNA        1146..1196
                     /label=sTRSV HHRz
                     /note="hammerhead ribozyme from the tobacco ringspot virus 
                     satellite RNA (Khvorova et al., 2003)"
     misc_feature    1225..1350
                     /label=similar to SynZip18
                     /note="similar to SynZip18"
     misc_feature    1351..1365
                     /label=similar to Linker GGSGG
                     /note="similar to Linker GGSGG"
     misc_feature    1366..2220
                     /label=similar to T3 fragment of T7 RNAP
                     /note="similar to T3 fragment of T7 RNAP"
     misc_feature    2230..2276
                     /label=Terminator L3S3P11
                     /note="Terminator L3S3P11"
     misc_feature    2342..2485
                     /label=Terminator DT25
                     /note="Terminator DT25"
     misc_feature    complement(2542..3396)
                     /label=similar to CGG fragment of T7 RNAP
                     /note="similar to CGG fragment of T7 RNAP"
     misc_feature    complement(3397..3411)
                     /label=similar to Linker GGSGG
                     /note="similar to Linker GGSGG"
     misc_feature    3412..3537
                     /label=similar to SynZip 18
                     /note="similar to SynZip 18"
     misc_feature    3579..3629
                     /label=Insulator BydvJ
                     /note="Insulator BydvJ"
     regulatory      3632..3803
                     /label=Promoter PcpcG2
                     /note="Promoter PcpcG2"
                     /regulatory_class="promoter"
     terminator      3943..4029
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     rep_origin      complement(4198..4743)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     misc_feature    4849..4899
                     /label=Terminator L3S1P13
                     /note="Terminator L3S1P13"
     CDS             complement(4910..5698)
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     regulatory      5699..5846
                     /regulatory_class="promoter"