Basic Vector Information
- Vector Name:
- pJFR2
- Antibiotic Resistance:
- Streptomycin
- Length:
- 5846 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Fernandez-Rodriguez J, Moser F, Voigt CA.
pJFR2 vector Vector Map
pJFR2 vector Sequence
LOCUS 40924_26026 5846 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pJFR2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5846) AUTHORS Fernandez-Rodriguez J, Moser F, Voigt CA. TITLE Multichromatic Bacterial Photography JOURNAL Unpublished REFERENCE 2 (bases 1 to 5846) AUTHORS Fernandez-Rodriguez J, Moser F, Voigt CA. TITLE Direct Submission JOURNAL Submitted (31-MAR-2016) Biological Engineering, MIT, 500 Tech Square, Rm 140, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 5846) TITLE Direct Submission REFERENCE 4 (bases 1 to 5846) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAR-2016) Biological Engineering, MIT, 500 Tech Square, Rm 140, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5846 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 46..292 /label=Promoter FixK2 /note="Promoter FixK2" /regulatory_class="promoter" CDS 326..928 /codon_start=1 /product="PhlF" /label=PhlF /protein_id="ARG47674.1" /translation="MARTPSRSSIGSLRSPHTHKAILTSTIEILKECGYSGLSIESVAR RAGASKPTIYRWWTNKAALIAEVYENESEQVRKFPDLGSFKADLDFLLRNLWKVWRETI CGEAFRCVIAEAQLDPATLTQLKDQFMERRREMPKKLVENAISNGELPKDTNRELLLDM IFGFCWYRLLTEQLTVEQDIEEFTFLLINGVCPGTQR" terminator 952..1023 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1039..1066 /label=T7Te terminator /note="phage T7 early transcription terminator" misc_feature 1109..1138 /label=Operator PhlF /note="Operator PhlF" misc_RNA 1146..1196 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" misc_feature 1225..1350 /label=similar to SynZip18 /note="similar to SynZip18" misc_feature 1351..1365 /label=similar to Linker GGSGG /note="similar to Linker GGSGG" misc_feature 1366..2220 /label=similar to T3 fragment of T7 RNAP /note="similar to T3 fragment of T7 RNAP" misc_feature 2230..2276 /label=Terminator L3S3P11 /note="Terminator L3S3P11" misc_feature 2342..2485 /label=Terminator DT25 /note="Terminator DT25" misc_feature complement(2542..3396) /label=similar to CGG fragment of T7 RNAP /note="similar to CGG fragment of T7 RNAP" misc_feature complement(3397..3411) /label=similar to Linker GGSGG /note="similar to Linker GGSGG" misc_feature 3412..3537 /label=similar to SynZip 18 /note="similar to SynZip 18" misc_feature 3579..3629 /label=Insulator BydvJ /note="Insulator BydvJ" regulatory 3632..3803 /label=Promoter PcpcG2 /note="Promoter PcpcG2" /regulatory_class="promoter" terminator 3943..4029 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" rep_origin complement(4198..4743) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 4849..4899 /label=Terminator L3S1P13 /note="Terminator L3S1P13" CDS complement(4910..5698) /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" regulatory 5699..5846 /regulatory_class="promoter"
This page is informational only.