Basic Vector Information
- Vector Name:
- pJC8
- Antibiotic Resistance:
- Apramycin
- Length:
- 13053 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Lam KN, Hall MW, Engel K, Vey G, Cheng J, Neufeld JD, Charles TC.
- Promoter:
- lac
pJC8 vector Vector Map
pJC8 vector Sequence
LOCUS 40924_25981 13053 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pJC8, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 13053) AUTHORS Lam KN, Hall MW, Engel K, Vey G, Cheng J, Neufeld JD, Charles TC. TITLE Evaluation of a pooled strategy for high-throughput sequencing of cosmid clones from metagenomic libraries JOURNAL PLoS ONE 9 (6), E98968 (2014) PUBMED 24911009 REFERENCE 2 (bases 1 to 13053) AUTHORS Cheng J, Charles TC. TITLE Direct Submission JOURNAL Submitted (08-NOV-2012) Biology, University of Waterloo, 200 University Avenue West, Waterloo, Ontario N2L 3G1, Canada REFERENCE 3 (bases 1 to 13053) TITLE Direct Submission REFERENCE 4 (bases 1 to 13053) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2014"; volume: "9"; issue: "6"; pages: "E98968" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-NOV-2012) Biology, University of Waterloo, 200 University Avenue West, Waterloo, Ontario N2L 3G1, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..13053 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 252..268 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 282..381 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS complement(498..1262) /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" protein_bind complement(1455..1554) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" primer_bind complement(1573..1589) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1597..1613) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1621..1651) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1666..1687) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(1922..2290) /label=traJ /note="oriT-recognizing protein" oriT complement(2323..2432) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(3116..3763) /label=TetR /note="tetracycline resistance regulatory protein" CDS 3869..5065 /label=TcR /note="tetracycline efflux protein" misc_recomb 5436..5668 /note="cos; lambda cos site" CDS complement(7470..8615) /label=trfA /note="trans-acting replication protein that binds to and activates oriV" CDS complement(8664..9014) /codon_start=1 /gene="ssB" /product="single-stranded DNA binding protein" /label=ssB /protein_id="AGA63627.1" /translation="MSHNQFQFIGNLTRDTEVRHGNSNKPQAIFDIAVNEEWRNDAGDK QERTDFFRIKCFGSQAEAHGKYLGKGSLVFVQGKIRNTKYEKDGQTVYGTDFIADKVDY LDTKAPGGSNQE" gene complement(8664..9014) /gene="ssB" /label=ssB CDS 9189..9500 /codon_start=1 /gene="trbA" /product="TrbA" /label=trbA /note="regulation of tra gene expression" /protein_id="AGA63628.1" /translation="MTKHELSERAGVSISFLSDLTNGKANPSLKVMEAIADALETPLPL LLESTDLDREALAEIAGHPFKSSVPPGYERISVVLPSHKAFIVKKWGDDTRKKLRGRL" gene 9189..9500 /gene="trbA" /label=trbA CDS complement(10538..11632) /codon_start=1 /gene="incC" /product="plasmid maintenance protein" /label=incC /protein_id="AGA63629.1" /translation="MGVIHEETAYRKPVPGGDPGAGSGAADHRDSAGRLSRWEATGDVR NVAGTDQGRSVASGASRVGRVRGQELARGVRAGNGGSAGTSGVHRPEVGSGRQEKTGNQ TMKTLVTANQKGGVGKTSTLVHLAFDFFERGLRVAVIDLDPQGNASYTLKDFATGLHAS KLFGAVPAGGWTETAPAAGDGQAARLALIESNPVLANAERLSLDDARELFGANIKALAN QGFDVCLIDTAPTLGVGLAAALFAADYVLSPIELEAYSIQGIKKMVTTIANVRQKNAKL QFLGMVPSKVDARNPRHARHQAELLAAYPKMMIPATVGLRSSIADALASGVPVWKIKKT AARKASKEVRALADYVFTKMEISQ" gene complement(10538..11632) /gene="incC" /label=incC CDS complement(11314..11619) /codon_start=1 /gene="korA" /product="KorA" /label=korA /note="regulation of gene expression" /protein_id="AGA63624.1" /translation="MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLG LTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQETKR" gene complement(11314..11619) /gene="korA" /label=korA rep_origin complement(12084..12795) /direction=LEFT /label=oriV /note="incP origin of replication"
This page is informational only.