Basic Vector Information
- Vector Name:
- pJAK16-Blue
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 12577 bp
- Type:
- Cloning vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Kornacki JA.
pJAK16-Blue vector Vector Map
pJAK16-Blue vector Sequence
LOCUS V005377 12577 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005377 VERSION V005377 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 12577) AUTHORS Kornacki JA. TITLE A family of broad-host-range vectors for expression of cloned genes in Gram-negative bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 12577) AUTHORS Xu K, Figurski DH. TITLE Direct Submission JOURNAL Submitted (12-JUL-2012) Microbiology and Immunology, Columbia University, 701W, 168th Street, Room 1514A, NYC, NY 10027, USA REFERENCE 3 (bases 1 to 12577) TITLE Direct Submission REFERENCE 4 (bases 1 to 12577) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-JUL-2012) Microbiology and Immunology, Columbia University, 701W, 168th Street, Room 1514A, NYC, NY 10027, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12577 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 121..207 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 299..326 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" promoter 345..436 /label="AmpR promoter" CDS 2218..2856 /gene="cmlA" /label="Chloramphenicol acetyltransferase 2" /note="Chloramphenicol acetyltransferase 2 from Escherichia coli. Accession#: P22615" rep_origin complement(5153..5547) /direction=LEFT /label="RSF1010 oriV" /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" oriT 5889..5976 /label="RSF1010 oriT" /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 7215..8183 /label="RSF1010 RepB" /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 8697..9533 /label="RSF1010 RepA" /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 9523..10371 /label="RSF1010 RepC" /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" regulatory 10535..10565 /label="P5 promoter" /note="P5 promoter" /regulatory_class="promoter" CDS complement(10794..11609) /codon_start=1 /product="LacI" /label="LacI" /note="represses the expression of downstream lacZ-alpha gene and relives the repression when IPTG is added" /protein_id="AFS32163.1" /translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSR ADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPA LFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKY LTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLR VGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTTWTACCNSLRARR" promoter complement(11733..11810) /label="lacIq promoter" /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 12040..12068 /label="tac promoter" /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 12076..12092 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter 12148..12166 /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" misc_feature complement(12179..12286) /label="MCS" /note="pBluescript multiple cloning site" promoter complement(12295..12313) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(12323..12339) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 12528..12545 /note="pBAD_rev_primer; pTrcHis_rev_primer"
This page is informational only.