Basic Vector Information
- Vector Name:
- pJAK12-Blue
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11097 bp
- Type:
- Cloning vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Kornacki JA.
pJAK12-Blue vector Map
pJAK12-Blue vector Sequence
LOCUS 40924_25861 11097 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pJAK12-Blue, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11097) AUTHORS Kornacki JA. TITLE A family of broad-host-range vectors for expression of cloned genes in Gram-negative bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 11097) AUTHORS Xu K, Figurski DH. TITLE Direct Submission JOURNAL Submitted (12-JUL-2012) Microbiology and Immunology, Columbia University, 701W, 168th Street, Room 1514A, NYC, NY 10027, USA REFERENCE 3 (bases 1 to 11097) TITLE Direct Submission REFERENCE 4 (bases 1 to 11097) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-JUL-2012) Microbiology and Immunology, Columbia University, 701W, 168th Street, Room 1514A, NYC, NY 10027, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11097 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 121..207 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 299..326 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 345..436 /label=AmpR promoter CDS 1498..2286 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" rep_origin complement(3673..4067) /direction=LEFT /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" oriT 4409..4496 /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 5735..6703 /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 7217..8053 /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 8043..8891 /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" regulatory 9055..9085 /label=P5 promoter /note="P5 promoter" /regulatory_class="promoter" CDS complement(9314..10129) /codon_start=1 /gene="lacI" /product="LacI" /label=lacI /note="represses the expression of downstream lacZ-alpha gene and relives the repression when IPTG is added" /protein_id="AFS32168.1" /translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSR ADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPA LFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKY LTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLR VGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTTWTACCNSLRARR" gene complement(9314..10129) /gene="lacI" /label=lacI promoter complement(10253..10330) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 10560..10588 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 10596..10612 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter 10668..10686 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" misc_feature complement(10699..10806) /label=MCS /note="pBluescript multiple cloning site" promoter complement(10815..10833) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(10843..10859) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 11048..11065 /note="pBAD_rev_primer; pTrcHis_rev_primer"
This page is informational only.