Basic Vector Information
- Vector Name:
- pISA417
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3851 bp
- Type:
- Bacterial expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pISA417 vector Vector Map
pISA417 vector Sequence
LOCUS 40924_25796 3851 bp DNA circular SYN 18-DEC-2018 DEFINITION Bacterial expression vector pISA417, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3851) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 3851) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 3851) TITLE Direct Submission REFERENCE 4 (bases 1 to 3851) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3851 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(399..775) /label=3' UTR of the cobA gene /note="3' UTR of the cobA gene" CDS complement(776..1549) /codon_start=1 /note="unnamed protein product; cobA" /protein_id="SJL88161.1" /translation="MTTTLLPGTVTLVGAGPGDPELVTVAGLRAVQQAEVILYDRLAPQ DLLSEASDDAELVPVGKIPRGHYVPQEEINQLLVAHAREGRKVVRLKGGDSFVFGRGGE EWQACAEAGIPVRVIPGVSSATAGPALAGIPLTHRHLVQGFTVVSGHVSPSDERSEVPW RQLAKDRLTLVILMGVAHMRDIAPELMAGGLPADTPVRVVSNASLASQESWRTTLGDAV ADMDAHHVRPPALVVVGTLAGVDLSHPDHRAPSDH" misc_feature complement(1550..1584) /label=5' UTR of the cobA gene /note="5' UTR of the cobA gene" primer_bind complement(1630..1646) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1654..1670) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1678..1708) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1723..1744) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2032..2620) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2794..3651) /label=AmpR /note="beta-lactamase" promoter complement(3652..3756) /label=AmpR promoter
This page is informational only.