pISA417 vector (V005388)

LOCUS       40924_25796        3851 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Bacterial expression vector pISA417, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3851)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3851)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 3851)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3851)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3851
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     379..395
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    complement(399..775)
                     /label=3' UTR of the cobA gene
                     /note="3' UTR of the cobA gene"
     CDS             complement(776..1549)
                     /codon_start=1
                     /note="unnamed protein product; cobA"
                     /protein_id="SJL88161.1"
                     /translation="MTTTLLPGTVTLVGAGPGDPELVTVAGLRAVQQAEVILYDRLAPQ
                     DLLSEASDDAELVPVGKIPRGHYVPQEEINQLLVAHAREGRKVVRLKGGDSFVFGRGGE
                     EWQACAEAGIPVRVIPGVSSATAGPALAGIPLTHRHLVQGFTVVSGHVSPSDERSEVPW
                     RQLAKDRLTLVILMGVAHMRDIAPELMAGGLPADTPVRVVSNASLASQESWRTTLGDAV
                     ADMDAHHVRPPALVVVGTLAGVDLSHPDHRAPSDH"
     misc_feature    complement(1550..1584)
                     /label=5' UTR of the cobA gene
                     /note="5' UTR of the cobA gene"
     primer_bind     complement(1630..1646)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(1654..1670)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1678..1708)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(1723..1744)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(2032..2620)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2794..3651)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(3652..3756)
                     /label=AmpR promoter