Basic Vector Information
- Vector Name:
- pInSRT-GFPV3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7667 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wasa J, Nishida Y, Shinomura T, Urakawa H, Arai E, Futamura N, Tsukushi S, Ishiguro N.
- Promoter:
- SP6
pInSRT-GFPV3 vector Map
pInSRT-GFPV3 vector Sequence
LOCUS 40924_25566 7667 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pInSRT-GFPV3 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7667) AUTHORS Wasa J, Nishida Y, Shinomura T, Urakawa H, Arai E, Futamura N, Tsukushi S, Ishiguro N. TITLE Versican Regulates Cell-Associated Matrix Formation and Cell Behavior Differentially from Aggrecan in Swarm Rat Chondrosarcoma Cells JOURNAL Unpublished REFERENCE 2 (bases 1 to 7667) AUTHORS Shinomura T. TITLE Direct Submission JOURNAL Submitted (28-JUN-2010) Contact:Tamayuki Shinomura Tokyo Medical and Dental University, Tissue Regeneration; 1-5-45 Yushima, Bunkyo-Ku, Tokyo 113-8549, Japan REFERENCE 3 (bases 1 to 7667) TITLE Direct Submission REFERENCE 4 (bases 1 to 7667) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-JUN-2010) Contact:Tamayuki Shinomura Tokyo Medical and Dental University, Tissue Regeneration; 1-5-45 Yushima, Bunkyo-Ku, Tokyo 113-8549, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7667 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 14..32 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" protein_bind 50..97 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." misc_feature 177..236 /gene="GFPV3" /label=signal sequence derived from human PG-M/versican /note="signal sequence derived from human PG-M/versican" CDS 279..995 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" misc_feature 3035..3621 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 3622..4218 /codon_start=1 /label=PuroR /note="puromycin N-acetyltransferase" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA" polyA_signal 4308..4532 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" promoter complement(4566..4584) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4591..4607) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin complement(4748..5203) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 5537..5641 /label=AmpR promoter CDS 5642..6499 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCHTLLSRIDAGQEQLGRRARYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 6673..7261 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 7549..7570 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 7585..7615 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 7623..7639 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 7647..7663 /label=M13 rev /note="common sequencing primer, one of multiple similar variants"
This page is informational only.