Basic Vector Information
- Vector Name:
- pInSRT-GFPV1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 12929 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wasa J, Nishida Y, Shinomura T, Urakawa H, Arai E, Futamura N, Tsukushi S, Ishiguro N.
pInSRT-GFPV1 vector Vector Map
pInSRT-GFPV1 vector Sequence
LOCUS 40924_25561 12929 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pInSRT-GFPV1 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12929) AUTHORS Wasa J, Nishida Y, Shinomura T, Urakawa H, Arai E, Futamura N, Tsukushi S, Ishiguro N. TITLE Versican Regulates Cell-Associated Matrix Formation and Cell Behavior Differentially from Aggrecan in Swarm Rat Chondrosarcoma Cells JOURNAL Unpublished REFERENCE 2 (bases 1 to 12929) AUTHORS Shinomura T. TITLE Direct Submission JOURNAL Submitted (28-JUN-2010) Contact:Tamayuki Shinomura Tokyo Medical and Dental University, Tissue Regeneration; 1-5-45 Yushima, Bunkyo-Ku, Tokyo 113-8549, Japan REFERENCE 3 (bases 1 to 12929) TITLE Direct Submission REFERENCE 4 (bases 1 to 12929) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-JUN-2010) Contact:Tamayuki Shinomura Tokyo Medical and Dental University, Tissue Regeneration; 1-5-45 Yushima, Bunkyo-Ku, Tokyo 113-8549, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12929 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 14..32 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" protein_bind 50..97 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." misc_feature 177..236 /gene="GFPV1" /label=signal sequence derived from human PG-M/versican /note="signal sequence derived from human PG-M/versican" CDS 279..995 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" misc_feature 8297..8883 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 8884..9480 /codon_start=1 /label=PuroR /note="puromycin N-acetyltransferase" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA" polyA_signal 9570..9794 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" promoter complement(9828..9846) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(9853..9869) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin complement(10010..10465) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 10799..10903 /label=AmpR promoter CDS 10904..11761 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCHTLLSRIDAGQEQLGRRARYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 11935..12523 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 12811..12832 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 12847..12877 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 12885..12901 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 12909..12925 /label=M13 rev /note="common sequencing primer, one of multiple similar variants"
This page is informational only.