pInSRT vector (V005424)

Download GeneBank File(.gb)

LOCUS       40924_25551        4772 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pInSRT DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4772)
  AUTHORS   Shinomura T, Nakamura S, Ito K, Shirasawa S, Hook M, Kimura JH.
  TITLE     Adsorption of Follicular Dendritic Cell-secreted Protein (FDC-SP) 
            onto Mineral Deposits: APPLICATION OF A NEW STABLE GENE EXPRESSION 
            SYSTEM
  JOURNAL   J. Biol. Chem. 283 (48), 33658-33664 (2008)
  PUBMED    18806264
REFERENCE   2  (bases 1 to 4772)
  AUTHORS   Shinomura T.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2008) Contact:Tamayuki Shinomura Tokyo Medical and
            Dental University, Graduate School, Tissue Regeneration; 1-5-45 
            Yushima, Bunkyo-ku, Tokyo 113-8549, Japan
REFERENCE   3  (bases 1 to 4772)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4772)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. Biol. 
            Chem."; date: "2008"; volume: "283"; issue: "48"; pages: 
            "33658-33664"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (11-JAN-2008) Contact:Tamayuki Shinomura Tokyo Medical and Dental 
            University, Graduate School, Tissue Regeneration; 1-5-45 Yushima, 
            Bunkyo-ku, Tokyo 113-8549, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4772
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        14..32
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     protein_bind    50..97
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_feature    140..726
                     /label=IRES2
                     /note="internal ribosome entry site (IRES) of the 
                     encephalomyocarditis virus (EMCV)"
     CDS             727..1323
                     /codon_start=1
                     /label=PuroR
                     /note="puromycin N-acetyltransferase"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     polyA_signal    1413..1637
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     promoter        complement(1671..1689)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(1696..1712)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      complement(1853..2308)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        2642..2746
                     /label=AmpR promoter
     CDS             2747..3604
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCHTLLSRIDAGQEQLGRRARYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      3778..4366
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    4654..4675
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4690..4720
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    4728..4744
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     4752..4768
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"