Basic Vector Information
- Vector Name:
- pIJ12738
- Antibiotic Resistance:
- Apramycin
- Length:
- 3562 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Fernandez-Martinez LT, Bibb MJ.
pIJ12738 vector Vector Map
pIJ12738 vector Sequence
LOCUS 40924_25446 3562 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pIJ12738, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3562) AUTHORS Fernandez-Martinez LT, Bibb MJ. TITLE Use of the meganuclease I-SceI of Saccharomyces cerevisiae to select for gene deletions in actinomycetes JOURNAL Sci Rep 4, 7100 (2014) PUBMED 25403842 REFERENCE 2 (bases 1 to 3562) AUTHORS Fernandez-Martinez LT, Bibb MJ. TITLE Direct Submission JOURNAL Submitted (13-JAN-2016) Biology, Edge Hill University, St Helens Road, Ormskirk L39 4QP, UK REFERENCE 3 (bases 1 to 3562) TITLE Direct Submission REFERENCE 4 (bases 1 to 3562) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep 4, 7100 (2014)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JAN-2016) Biology, Edge Hill University, St Helens Road, Ormskirk L39 4QP, UK" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3562 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 423..439 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" primer_bind 490..506 /label=SK primer /note="common sequencing primer, one of multiple similar variants" misc_feature complement(609..622) /label=fragment of lacZ alpha peptide /note="fragment of lacZ alpha peptide" primer_bind complement(623..639) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(647..663) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(671..701) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(716..737) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1025..1613) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1817..2617 /codon_start=1 /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG" oriT 3040..3149 /label=oriT /note="incP origin of transfer"
This page is informational only.