pIEF16S vector (V005453)

Basic Vector Information

Vector Name:
pIEF16S
Antibiotic Resistance:
Ampicillin
Length:
8247 bp
Type:
Delivery vector
Replication origin:
ori
Source/Author:
Zhang XZ, Yan X, Cui ZL, Hong Q, Li SP.

pIEF16S vector Map

pIEF16S8247 bp400800120016002000240028003200360040004400480052005600600064006800720076008000f1 oriM13 fwdT7 promoterdownstream sequence of Bacillus subtilis 16S rRNA generepeat_regionlacImazFPspac promoter functional regionspcrepeat_regionunstream sequence of Bacillus subtilis 16S rRNA genepromoter functional region of Escherichia coli lpp geneAntitoxin MazET3 promoterM13 revlac operatorlac promoterCAP binding siteoriAmpRAmpR promoter

pIEF16S vector Sequence

LOCUS       V005453                 8247 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005453
VERSION     V005453
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8247)
  AUTHORS   Zhang XZ, Yan X, Cui ZL, Hong Q, Li SP.
  TITLE     mazF, a novel counter-selectable marker for unmarked chromosomal
            manipulation in Bacillus subtilis
  JOURNAL   Nucleic Acids Res. 34 (9), E71 (2006)
   PUBMED   16714443
REFERENCE   2  (bases 1 to 8247)
  AUTHORS   Zhang X-Z., Li S-P.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JAN-2006) Department of Microbiology, College of Life
            Sciences, Nanjing Agricultral University, Key Laboratory for
            Microbiological Engineering of Agricultural Environment of Ministry
            of Agriculture, 6 Tongwei Road, Nanjing, Jiangsu 210095, China
REFERENCE   3  (bases 1 to 8247)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8247)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
            Acids Res."; date: "2006"; volume: "34"; issue: "9"; pages: "E71"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (10-JAN-2006) Department of Microbiology, College of Life Sciences,
            Nanjing Agricultral University, Key Laboratory for Microbiological
            Engineering of Agricultural Environment of Ministry of Agriculture,
            6 Tongwei Road, Nanjing, Jiangsu 210095, China"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8247
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      4..459
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        626..644
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    complement(674..1067)
                     /note="downstream sequence of Bacillus subtilis 16S rRNA
                     gene"
     repeat_region   1103..1227
     CDS             complement(1261..2340)
                     /label="lacI"
                     /note="lac repressor"
     CDS             complement(2593..2925)
                     /gene="mazF"
                     /label="Endoribonuclease toxin MazF"
                     /note="Endoribonuclease toxin MazF from Escherichia coli
                     (strain K12). Accession#: P0AE70"
     misc_feature    complement(2942..3230)
                     /label="Pspac promoter functional region"
                     /note="Pspac promoter functional region"
     protein_bind    2949..2965
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             3537..4289
                     /codon_start=1
                     /gene="spc"
                     /product="spectinomycin resistance marker"
                     /label="spc"
                     /protein_id="ABC88419.1"
                     /translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL
                     VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG
                     EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD
                     SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR
                     SYLGENIEWTNENVNLTINYLNNRLKKL"
     gene            3537..4289
                     /gene="spc"
                     /label="spc"
     repeat_region   4291..4415
     misc_feature    complement(4538..5537)
                     /note="unstream sequence of Bacillus subtilis 16S rRNA
                     gene"
     misc_feature    5544..5791
                     /note="promoter functional region of Escherichia coli lpp
                     gene"
     CDS             5792..6037
                     /gene="mazE"
                     /label="Antitoxin MazE"
                     /note="Antitoxin MazE from Escherichia coli (strain K12).
                     Accession#: P0AE72"
     promoter        complement(6059..6077)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(6098..6114)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(6122..6138)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6146..6176)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6191..6212)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(6500..7088)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(7262..8119)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8120..8224)
                     /label="AmpR promoter"

This page is informational only.