pIEF16S vector (V005453)

Download GeneBank File(.gb)

LOCUS       V005453                 8247 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005453
VERSION     V005453
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8247)
  AUTHORS   Zhang XZ, Yan X, Cui ZL, Hong Q, Li SP.
  TITLE     mazF, a novel counter-selectable marker for unmarked chromosomal
            manipulation in Bacillus subtilis
  JOURNAL   Nucleic Acids Res. 34 (9), E71 (2006)
   PUBMED   16714443
REFERENCE   2  (bases 1 to 8247)
  AUTHORS   Zhang X-Z., Li S-P.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JAN-2006) Department of Microbiology, College of Life
            Sciences, Nanjing Agricultral University, Key Laboratory for
            Microbiological Engineering of Agricultural Environment of Ministry
            of Agriculture, 6 Tongwei Road, Nanjing, Jiangsu 210095, China
REFERENCE   3  (bases 1 to 8247)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8247)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
            Acids Res."; date: "2006"; volume: "34"; issue: "9"; pages: "E71"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (10-JAN-2006) Department of Microbiology, College of Life Sciences,
            Nanjing Agricultral University, Key Laboratory for Microbiological
            Engineering of Agricultural Environment of Ministry of Agriculture,
            6 Tongwei Road, Nanjing, Jiangsu 210095, China"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8247
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      4..459
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        626..644
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    complement(674..1067)
                     /note="downstream sequence of Bacillus subtilis 16S rRNA
                     gene"
     repeat_region   1103..1227
     CDS             complement(1261..2340)
                     /label="lacI"
                     /note="lac repressor"
     CDS             complement(2593..2925)
                     /gene="mazF"
                     /label="Endoribonuclease toxin MazF"
                     /note="Endoribonuclease toxin MazF from Escherichia coli
                     (strain K12). Accession#: P0AE70"
     misc_feature    complement(2942..3230)
                     /label="Pspac promoter functional region"
                     /note="Pspac promoter functional region"
     protein_bind    2949..2965
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             3537..4289
                     /codon_start=1
                     /gene="spc"
                     /product="spectinomycin resistance marker"
                     /label="spc"
                     /protein_id="ABC88419.1"
                     /translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL
                     VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG
                     EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD
                     SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR
                     SYLGENIEWTNENVNLTINYLNNRLKKL"
     gene            3537..4289
                     /gene="spc"
                     /label="spc"
     repeat_region   4291..4415
     misc_feature    complement(4538..5537)
                     /note="unstream sequence of Bacillus subtilis 16S rRNA
                     gene"
     misc_feature    5544..5791
                     /note="promoter functional region of Escherichia coli lpp
                     gene"
     CDS             5792..6037
                     /gene="mazE"
                     /label="Antitoxin MazE"
                     /note="Antitoxin MazE from Escherichia coli (strain K12).
                     Accession#: P0AE72"
     promoter        complement(6059..6077)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(6098..6114)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(6122..6138)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6146..6176)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6191..6212)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(6500..7088)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(7262..8119)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8120..8224)
                     /label="AmpR promoter"