pHZ1358 vector (V005463)

Download GeneBank File(.gb)

LOCUS       V005463                10848 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005463
VERSION     V005463
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10848)
  AUTHORS   Sun Y, Zhou X, Liu J, Bao K, Zhang G, Tu G, Kieser T, Deng Z.
  TITLE     'Streptomyces nanchangensis', a producer of the insecticidal
            polyether antibiotic nanchangmycin and the antiparasitic macrolide
            meilingmycin, contains multiple polyketide gene clusters
  JOURNAL   Microbiology (Reading, Engl.) 148 (PT 2), 361-371 (2002)
   PUBMED   11832500
REFERENCE   2  (bases 1 to 10848)
  AUTHORS   Sun Y, Zhou X, Deng Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUN-2004) Bio-X Life Science Research Center, Shanghai
            Jiaotong University, 1954 Huashan Road, Shanghai 200030, P. R. China
REFERENCE   3  (bases 1 to 10848)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10848)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Microbiology (Reading, Engl.) 148 (PT 2), 361-371 (2002)"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (27-JUN-2004) Bio-X Life Science Research Center, Shanghai Jiaotong
            University, 1954 Huashan Road, Shanghai 200030, P. R. China"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10848
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        complement(4..22)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     promoter        137..241
                     /label="AmpR promoter"
     CDS             242..1099
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      1273..1861
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     rep_origin      1927..2058
                     /label="ColE1 replication origin"
                     /note="ColE1 replication origin"
     polyA_signal    complement(2257..2391)
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     CDS             complement(2816..2836)
                     /label="SV40 NLS"
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     intron          complement(2966..3031)
                     /label="small t intron"
                     /note="SV40 (simian virus 40) small t antigen intron"
     repeat_region   3110..3145
     CDS             complement(3454..4245)
                     /label="NeoR/KanR"
                     /note="aminoglycoside phosphotransferase"
     misc_feature    4366..4441
                     /note="pIJ101 sti region; site of second strand synthesis"
     CDS             complement(4940..6310)
                     /codon_start=1
                     /gene="rep"
                     /product="pIJ101 replication protein"
                     /label="rep"
                     /note="essential for replication of plasmid pIJ101"
                     /protein_id="AAU06203.1"
                     /translation="MDPASGVIVAQTAAGTSVVLGLMRCGRIWLCPVCAATIRHKRAEE
                     ITAAVVEWIKRGGTAYLVTFTARHGHTDRLADLMDALQGTRKTPDSPRRPGAYQRLITG
                     GTWAGRRAKDGHRAADREGIRDRIGYVGMIRATEVTVGQINGWHPHIHAIVLVGGRTEG
                     ERSAKQIVATFEPTGAALDEWQGHWRSVWTAALRKVNPAFTPDDRHGVDFKRLETERDA
                     NDLAEYIAKTQDGKAPALELARADLKTATGGNVAPFELLGRIGDLTGGMTEDDAAGVGS
                     LEWNLSRWHEYERATRGRRAIEWTRYLRQMLGLDGGDTEADDLDLLLAADADGGELRAG
                     VAVTEDGWHAVTRRALDLEATRAAEGKDGNEDSAAVGERVREVLALADAADTVVVLTAG
                     EVAEAYADMLAALAQRREEATARRRREQDDDQDDDADDRQERAARHIARLASGPTSH"
     gene            complement(4940..6310)
                     /gene="rep"
                     /label="rep"
     CDS             7576..8382
                     /gene="tsnR"
                     /label="23S rRNA (adenosine(1067)-2'-O)-methyltransferase"
                     /note="23S rRNA (adenosine(1067)-2'-O)-methyltransferase
                     from Streptomyces azureus. Accession#: P18644"
     repeat_region   8526..8561
     oriT            9043..9152
                     /label="oriT"
                     /note="incP origin of transfer"
     CDS             9185..9553
                     /label="traJ"
                     /note="oriT-recognizing protein"
     misc_feature    10481..10776
                     /label="bacteriophage lambda COS site"
                     /note="bacteriophage lambda COS site"
     promoter        10830..10848
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"