Basic Vector Information
- Vector Name:
- pHXGWA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7462 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Busso D, Delagoutte-Busso B, Moras D.
pHXGWA vector Map
pHXGWA vector Sequence
LOCUS 40924_25201 7462 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pHXGWA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7462) AUTHORS Busso D, Delagoutte-Busso B, Moras D. TITLE Construction of a set Gateway-based destination vectors for high-throughput cloning and expression screening in Escherichia coli JOURNAL Anal. Biochem. 343 (2), 313-321 (2005) PUBMED 15993367 REFERENCE 2 (bases 1 to 7462) AUTHORS Busso D, Delagoutte-Busso B, Salim L, Moras D. TITLE Direct Submission JOURNAL Submitted (25-APR-2008) Structural Biology and Genomics Platform, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France REFERENCE 3 (bases 1 to 7462) TITLE Direct Submission REFERENCE 4 (bases 1 to 7462) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Anal. Biochem."; date: "2005"; volume: "343"; issue: "2"; pages: "313-321" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-APR-2008) Structural Biology and Genomics Platform, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7462 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 27..45 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 46..70 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 85..107 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 126..143 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 150..473 /codon_start=1 /label=TrxA /note="E. coli thioredoxin" /translation="SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEI ADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLD ANLA" protein_bind 492..616 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 641..671 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 725..1381 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 1726..2028 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2072..2196) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 2210..2227 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2294..2341 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 2378..2833 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2860..2964 /label=AmpR promoter CDS 2965..3822 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 3996..4584 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4770..4912) /label=bom /note="basis of mobility region from pBR322" CDS complement(5017..5205) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(5980..6001) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(6017..7096) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(7097..7174) /label=lacI promoter
This page is informational only.