Basic Vector Information
- Vector Name:
- pHRP315
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4796 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Okamoto S, Niki H.
pHRP315 vector Map
pHRP315 vector Sequence
LOCUS 40924_24992 4796 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pHRP315 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4796) AUTHORS Okamoto S, Niki H. TITLE pHRP315 sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 4796) AUTHORS Okamoto S, Niki H. TITLE Direct Submission JOURNAL Submitted (26-JAN-2016) Contact:Sho Okamoto National Institute of Genetics, Microbial Genetics Laboratory, Genetics Strains Reseach Center; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.nig.ac.jp/labs/MicroGen/index.html REFERENCE 3 (bases 1 to 4796) TITLE Direct Submission REFERENCE 4 (bases 1 to 4796) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-JAN-2016) Contact:Sho Okamoto National Institute of Genetics, Microbial Genetics Laboratory, Genetics Strains Reseach Center; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.nig.ac.jp/labs/MicroGen/index.html" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4796 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(16..604) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(778..1635) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(1636..1740) /label=AmpR promoter primer_bind 2214..2230 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 2932..3921 /codon_start=1 /product="streptomycin 3'-adenylyltransferase" /label=streptomycin 3'-adenylyltransferase /protein_id="BAU45357.1" /translation="MRSRNWSRTLTERSGGNGAVAVFMACYDCFFGVQSMPRASKQQAR YAVGRCLMLWSSNDVTQQGSRPKTKLNIMREAVIAEVSTQLSEVVGVIERHLEPTLLAV HLYGSAVDGGLKPPEPHSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVE VTIVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALV GPAAEELFDPVPEQDLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPK DVAADWAMERLPAQYQPVILEARQAYLGQEEDRLASRADQLEEFVHYV" primer_bind complement(4410..4426) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4434..4450) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4458..4488) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4503..4524) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP."
This page is informational only.