Basic Vector Information
- Vector Name:
- pHR-Ech_0230-tuf-aadA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7173 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wang Y, Wei L, Liu H, Cheng C, Ganta RR.
pHR-Ech_0230-tuf-aadA vector Map
pHR-Ech_0230-tuf-aadA vector Sequence
LOCUS 40924_24867 7173 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pHR-Ech_0230-tuf-aadA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7173) AUTHORS Wang Y, Wei L, Liu H, Cheng C, Ganta RR. TITLE A genetic system for targeted mutations to disrupt and restore genes in the obligate bacterium, Ehrlichia chaffeensis JOURNAL Sci Rep 1, 15801 (2017) PUBMED 29150636 REFERENCE 2 (bases 1 to 7173) AUTHORS Ganta RR. TITLE Direct Submission JOURNAL Submitted (08-MAY-2017) Department of Diagnostic Medicine/Pathobiology, College of Veterinary Medicine, Kansas State University, 1800 Denison Ave, Manhattan, KS 66503, USA REFERENCE 3 (bases 1 to 7173) TITLE Direct Submission REFERENCE 4 (bases 1 to 7173) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep 1, 15801 (2017)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-MAY-2017) Department of Diagnostic Medicine/Pathobiology, College of Veterinary Medicine, Kansas State University, 1800 Denison Ave, Manhattan, KS 66503, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7173 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 107..128 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 143..173 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 181..197 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 205..221 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 295..1333 /label=Ehrlichia chaffeensis str. Arkansas genomic region /note="Ehrlichia chaffeensis str. Arkansas genomic region" regulatory 1334..1706 /gene="tuf-2" /regulatory_class="promoter" gene 1334..1706 /gene="tuf-2" /label=tuf-2 CDS 1707..2495 /codon_start=1 /gene="aadA" /product="aminoglycoside-3'-adenylyltransferase" /label=aadA /protein_id="ATY38622.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" gene 1707..2495 /gene="aadA" /label=aadA misc_feature 2502..3536 /label=Ehrlichia chaffeensis str. Arkansas genomic region /note="Ehrlichia chaffeensis str. Arkansas genomic region" promoter complement(3607..3625) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3632..3648) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 3789..4217 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS 4561..5352 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" CDS 5373..6230 /label=AmpR /note="beta-lactamase" rep_origin 6404..6992 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.