Basic Vector Information
- Vector Name:
- pHisJM
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4506 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Masuda J, Takayama E, Satoh A, Kojima-Aikawa K, Suzuki K, Matsumoto I.
pHisJM vector Vector Map
pHisJM vector Sequence
LOCUS 40924_24673 4506 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pHisJM DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4506) AUTHORS Masuda J, Takayama E, Satoh A, Kojima-Aikawa K, Suzuki K, Matsumoto I. TITLE A novel expression vector, designated as pHisJM, for producing recombinant His-fusion proteins JOURNAL Biotechnol. Lett. 26 (20), 1543-1548 (2004) PUBMED 15604794 REFERENCE 2 (bases 1 to 4506) AUTHORS Masuda J. TITLE Direct Submission JOURNAL Submitted (05-AUG-2003) Contact:Junko Masuda Ochanomizu University, Graduate School of Humanities and Sciences; 2-1-1 Otsuka, Bunkyo-ku, Tokyo 112-8610, Japan REFERENCE 3 (bases 1 to 4506) TITLE Direct Submission REFERENCE 4 (bases 1 to 4506) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Lett."; date: "2004"; volume: "26"; issue: "20"; pages: "1543-1548" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-AUG-2003) Contact:Junko Masuda Ochanomizu University, Graduate School of Humanities and Sciences; 2-1-1 Otsuka, Bunkyo-ku, Tokyo 112-8610, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4506 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 183..211 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 219..235 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 270..287 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 291..323 /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" CDS 327..350 /codon_start=1 /label=Xpress(TM) tag /note="Xpress(TM) epitope tag, including an enterokinase recognition and cleavage site" /translation="DLYDDDDK" terminator 472..519 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" promoter 809..913 /label=AmpR promoter CDS 914..1771 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1945..2533 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 2777..2854 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 2855..3934 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 3950..3971 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3986..4016 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 4024..4040 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 4060..4233 /codon_start=1 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART DRPSQQLRSLNGE"
This page is informational only.