Basic Vector Information
- Vector Name:
- pHis-p65f2-286
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6347 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pHis-p65f2-286 vector Vector Map
pHis-p65f2-286 vector Sequence
LOCUS 40924_24603 6347 bp DNA circular SYN 18-DEC-2018 DEFINITION Mammalian expression vector pHis-p65f2-286, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6347) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6347) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6347) TITLE Direct Submission REFERENCE 4 (bases 1 to 6347) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6347 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 235..614 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 615..818 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 863..881 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 932..949 /label=6xHis /note="6xHis affinity tag" CDS 953..985 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" CDS 989..1012 /label=Xpress(TM) tag /note="Xpress(TM) epitope tag, including an enterokinase recognition and cleavage site" CDS 1019..1873 /codon_start=1 /note="unnamed protein product; p65f" /protein_id="SJL87586.1" /translation="DELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSI PGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELC PDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVT VRDPSGRPLRLPPVLPHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKED IEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSE PMEF" polyA_signal 1944..2168 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 2214..2642 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2656..2985 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 3052..3843 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 4020..4153 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(4190..4206) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4214..4230) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4238..4268) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4283..4304) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4592..5180) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5354..6211) /label=AmpR /note="beta-lactamase" promoter complement(6212..6316) /label=AmpR promoter
This page is informational only.