Basic Vector Information
The pHERD30T is a bacterial broad-host vector, especially suitable for Pseudomonas aeruginosa.
- Vector Name:
- pHERD30T (unavailable)
- Antibiotic Resistance:
- Gentamicin
- Length:
- 5216 bp
- Type:
- Escherichia-Pseudomonas shuttle vector
- Replication origin:
- ori
- Source/Author:
- Qiu D, Damron FH, Mima T, Schweizer HP, Yu HD.
- Promoter:
- araBAD
pHERD30T (unavailable) vector Vector Map
References
- Pinilla-Redondo R, Shehreen S, Marino ND, Fagerlund RD, Brown CM, Sørensen SJ, Fineran PC, Bondy-Denomy J. Discovery of multiple anti-CRISPRs highlights anti-defense gene clustering in mobile genetic elements. Nat Commun. 2020 Nov 6;11(1):5652.
pHERD30T (unavailable) vector Sequence
LOCUS 40924_24488 5216 bp DNA circular SYN 18-DEC-2018 DEFINITION Escherichia-Pseudomonas shuttle vector pHERD30T, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5216) AUTHORS Qiu D, Damron FH, Mima T, Schweizer HP, Yu HD. TITLE PBAD-based shuttle vectors for functional analysis of toxic and highly regulated genes in Pseudomonas and Burkholderia spp. and other bacteria JOURNAL Appl. Environ. Microbiol. 74 (23), 7422-7426 (2008) PUBMED 18849445 REFERENCE 2 (bases 1 to 5216) AUTHORS Qiu D, Yu HD. TITLE Direct Submission JOURNAL Submitted (31-MAR-2008) Biochemistry and Microbiology, Marshall University Joan C. Edwards School of Medicine, 1 John Marshall Drive, Huntington, WV 25755, USA REFERENCE 3 (bases 1 to 5216) TITLE Direct Submission REFERENCE 4 (bases 1 to 5216) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2008"; volume: "74"; issue: "23"; pages: "7422-7426" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAR-2008) Biochemistry and Microbiology, Marshall University Joan C. Edwards School of Medicine, 1 John Marshall Drive, Huntington, WV 25755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5216 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(733..1263) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(1452..1480) /label=Pc promoter /note="class 1 integron promoter" rep_origin complement(1521..1872) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 1886..2716 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" primer_bind 2880..2896 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(2900..2956) /label=MCS /note="pUC18/19 multiple cloning site" RBS complement(2982..3004) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" promoter complement(3031..3315) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 3342..4217 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" oriT 4377..4485 /label=oriT /note="incP origin of transfer" rep_origin complement(4557..5145) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.