Basic Vector Information
- Vector Name:
- pHERD28T
- Antibiotic Resistance:
- Trimethoprim
- Length:
- 4993 bp
- Type:
- Escherichia-Pseudomonas shuttle vector
- Replication origin:
- ori
- Source/Author:
- Qiu D, Damron FH, Mima T, Schweizer HP, Yu HD.
- Promoter:
- araBAD
pHERD28T vector Vector Map
pHERD28T vector Sequence
LOCUS 40924_24483 4993 bp DNA circular SYN 18-DEC-2018 DEFINITION Escherichia-Pseudomonas shuttle vector pHERD28T, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4993) AUTHORS Qiu D, Damron FH, Mima T, Schweizer HP, Yu HD. TITLE PBAD-based shuttle vectors for functional analysis of toxic and highly regulated genes in Pseudomonas and Burkholderia spp. and other bacteria JOURNAL Appl. Environ. Microbiol. 74 (23), 7422-7426 (2008) PUBMED 18849445 REFERENCE 2 (bases 1 to 4993) AUTHORS Qiu D, Yu HD. TITLE Direct Submission JOURNAL Submitted (31-MAR-2008) Biochemistry and Microbiology, Marshall University Joan C. Edwards School of Medicine, 1 John Marshall Drive, Huntington, WV 25755, USA REFERENCE 3 (bases 1 to 4993) TITLE Direct Submission REFERENCE 4 (bases 1 to 4993) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2008"; volume: "74"; issue: "23"; pages: "7422-7426" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAR-2008) Biochemistry and Microbiology, Marshall University Joan C. Edwards School of Medicine, 1 John Marshall Drive, Huntington, WV 25755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4993 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(660..893) /codon_start=1 /label=TpR /note="E. coli plasmid-associated dihydrofolate reductase" /translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW YCTKLTPEGYAVESESHPGSVQIYPVAALERVA" promoter complement(1220..1248) /label=Pc promoter /note="class 1 integron promoter" rep_origin complement(1298..1649) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 1663..2493 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" primer_bind 2657..2673 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(2677..2733) /label=MCS /note="pUC18/19 multiple cloning site" RBS complement(2759..2781) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" promoter complement(2808..3092) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 3119..3994 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" oriT 4154..4262 /label=oriT /note="incP origin of transfer" rep_origin complement(4334..4922) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.