Basic Vector Information
- Vector Name:
- pHERD26T
- Antibiotic Resistance:
- Tetracycline
- Length:
- 6166 bp
- Type:
- Escherichia-Pseudomonas shuttle vector
- Replication origin:
- ori
- Source/Author:
- Qiu D, Damron FH, Mima T, Schweizer HP, Yu HD.
- Promoter:
- araBAD
pHERD26T vector Map
pHERD26T vector Sequence
LOCUS 40924_24478 6166 bp DNA circular SYN 18-DEC-2018 DEFINITION Escherichia-Pseudomonas shuttle vector pHERD26T, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6166) AUTHORS Qiu D, Damron FH, Mima T, Schweizer HP, Yu HD. TITLE PBAD-based shuttle vectors for functional analysis of toxic and highly regulated genes in Pseudomonas and Burkholderia spp. and other bacteria JOURNAL Appl. Environ. Microbiol. 74 (23), 7422-7426 (2008) PUBMED 18849445 REFERENCE 2 (bases 1 to 6166) AUTHORS Qiu D, Yu HD. TITLE Direct Submission JOURNAL Submitted (31-MAR-2008) Biochemistry and Microbiology, Marshall University Joan C. Edwards School of Medicine, 1 John Marshall Drive, Huntington, WV 25755, USA REFERENCE 3 (bases 1 to 6166) TITLE Direct Submission REFERENCE 4 (bases 1 to 6166) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2008"; volume: "74"; issue: "23"; pages: "7422-7426" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAR-2008) Biochemistry and Microbiology, Marshall University Joan C. Edwards School of Medicine, 1 John Marshall Drive, Huntington, WV 25755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6166 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(46..397) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 411..1241 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" primer_bind 1405..1421 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(1425..1481) /label=MCS /note="pUC18/19 multiple cloning site" RBS complement(1507..1529) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" promoter complement(1556..1840) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 1867..2742 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" oriT 2902..3010 /label=oriT /note="incP origin of transfer" rep_origin complement(3082..3670) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4495..5682) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(5730..5758) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" protein_bind 6005..6026 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6041..6071 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6079..6095 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6103..6119 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 6137..6155 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.