Basic Vector Information
- Vector Name:
- pMpGWB121
- Antibiotic Resistance:
- Streptomycin
- Length:
- 13860 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Ishizaki K, Nishihama R, Ueda M, Inoue K, Ishida S, Nishimura Y, Shikanai T, Kohchi T.
- Promoter:
- CaMV35S(enhanced)
pMpGWB121 vector Map
pMpGWB121 vector Sequence
LOCUS 40924_31385 13860 bp DNA circular SYN 18-DEC-2018
DEFINITION Binary vector pMpGWB121 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 13860)
AUTHORS Ishizaki K, Nishihama R, Ueda M, Inoue K, Ishida S, Nishimura Y,
Shikanai T, Kohchi T.
TITLE Development of Gateway Binary Vector Series with Four Different
Selection Markers for the Liverwort Marchantia polymorpha
JOURNAL PLoS ONE 10 (9), E0138876 (2015)
PUBMED 26406247
REFERENCE 2 (bases 1 to 13860)
AUTHORS Nishihama R, Ishizaki K, Kohchi T.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2015) Contact:Ryuichi Nishihama Kyoto University,
Graduate School of Biostudies; Kitashirakawa-oiwake-cho, Sakyo-ku,
Kyoto, Kyoto 606-8502, Japan URL :http://www.lif.kyoto-u.ac.jp/e/
REFERENCE 3 (bases 1 to 13860)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 13860)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2015"; volume: "10"; issue: "9"; pages: "E0138876"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-JUN-2015) Contact:Ryuichi Nishihama Kyoto University, Graduate
School of Biostudies"; volume: " Kitashirakawa-oiwake-cho, Sakyo-ku,
Kyoto, Kyoto 606-8502, Japan URL :http"; pages:
"//www.lif.kyoto-u.ac.jp/e"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..13860
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature complement(54..78)
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
primer_bind 281..297
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
regulatory 315..2043
/label=MpEF1alpha promoter and 5'UTR
/note="MpEF1alpha promoter and 5'UTR"
/regulatory_class="promoter"
protein_bind 2057..2181
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
promoter 2218..2248
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
CDS 2302..2958
/label=CmR
/note="chloramphenicol acetyltransferase"
CDS 3303..3605
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(3649..3773)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
misc_feature 3784..3819
/note="modified EAR motif plant-specific repression domain
showing strong repression activity (SRDX)"
CDS 3829..4704
/codon_start=1
/product="ligand binding domain of the glucocorticoid
receptor"
/label=ligand binding domain of the glucocorticoid rec
/note="region_name: GR; glucocorticoid receptor, a member
of the nuclear receptor superfamily"
/protein_id="BAS49678.1"
/translation="MASEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPAALPQLTPT
LVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLD
DQMTLLQYSWMFLMAFALGWRSYRQSSGNLLCFAPDLIINEQRMSLPCMYDQCKHMLFV
SSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNS
SQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNG
NIKKLLFHQK"
terminator 4720..4972
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
primer_bind complement(5006..5022)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 5030..5046
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(5054..5084)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(5099..5120)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
polyA_signal complement(5205..5379)
/label=CaMV poly(A) signal
/note="cauliflower mosaic virus polyadenylation signal"
CDS complement(5423..6445)
/label=HygR
/note="aminoglycoside phosphotransferase from E. coli"
promoter complement(6512..7187)
/label=CaMV 35S promoter (enhanced)
/note="cauliflower mosaic virus 35S promoter with a
duplicated enhancer region"
misc_feature complement(7382..7406)
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
CDS 7927..8715
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
rep_origin 8964..9552
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(9738..9878)
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(10222..10416)
/direction=LEFT
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(10485..11555)
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(11987..12613)
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
This page is informational only.