pMpGWB120 vector (V004653)

LOCUS       40924_31380       12126 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pMpGWB120 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12126)
  AUTHORS   Ishizaki K, Nishihama R, Ueda M, Inoue K, Ishida S, Nishimura Y, 
            Shikanai T, Kohchi T.
  TITLE     Development of Gateway Binary Vector Series with Four Different 
            Selection Markers for the Liverwort Marchantia polymorpha
  JOURNAL   PLoS ONE 10 (9), E0138876 (2015)
  PUBMED    26406247
REFERENCE   2  (bases 1 to 12126)
  AUTHORS   Nishihama R, Ishizaki K, Kohchi T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-2015) Contact:Ryuichi Nishihama Kyoto University, 
            Graduate School of Biostudies; Kitashirakawa-oiwake-cho, Sakyo-ku, 
            Kyoto, Kyoto 606-8502, Japan URL :http://www.lif.kyoto-u.ac.jp/e/
REFERENCE   3  (bases 1 to 12126)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12126)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; 
            date: "2015"; volume: "10"; issue: "9"; pages: "E0138876"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (01-JUN-2015) Contact:Ryuichi Nishihama Kyoto University, Graduate 
            School of Biostudies"; volume: " Kitashirakawa-oiwake-cho, Sakyo-ku,
            Kyoto, Kyoto 606-8502, Japan URL :http"; pages: 
            "//www.lif.kyoto-u.ac.jp/e"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12126
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(54..78)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     primer_bind     281..297
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    323..447
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        484..514
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     CDS             568..1224
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     CDS             1569..1871
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(1915..2039)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    2050..2085
                     /note="modified EAR motif plant-specific repression domain 
                     showing strong repression activity (SRDX)"
     CDS             2095..2970
                     /codon_start=1
                     /product="ligand binding domain of the glucocorticoid
                     receptor"
                     /label=ligand binding domain of the glucocorticoid rec
                     /note="region_name: GR; glucocorticoid receptor, a member
                     of the nuclear receptor superfamily"
                     /protein_id="BAS49674.1"
                     /translation="MASEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPAALPQLTPT
                     LVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLD
                     DQMTLLQYSWMFLMAFALGWRSYRQSSGNLLCFAPDLIINEQRMSLPCMYDQCKHMLFV
                     SSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNS
                     SQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNG
                     NIKKLLFHQK"
     terminator      2986..3238
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     primer_bind     complement(3272..3288)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    3296..3312
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3320..3350)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3365..3386)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     polyA_signal    complement(3471..3645)
                     /label=CaMV poly(A) signal
                     /note="cauliflower mosaic virus polyadenylation signal"
     CDS             complement(3689..4711)
                     /label=HygR
                     /note="aminoglycoside phosphotransferase from E. coli"
     promoter        complement(4778..5453)
                     /label=CaMV 35S promoter (enhanced)
                     /note="cauliflower mosaic virus 35S promoter with a
                     duplicated enhancer region"
     misc_feature    complement(5648..5672)
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     CDS             6193..6981
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     rep_origin      7230..7818
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(8004..8144)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8488..8682)
                     /direction=LEFT
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(8751..9821)
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(10253..10879)
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"