Basic Vector Information
- Vector Name:
- pMON93914
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11397 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
- Promoter:
- CaMV 35S
pMON93914 vector Map
pMON93914 vector Sequence
LOCUS V004679 11397 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004679 VERSION V004679 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 11397) AUTHORS Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME. TITLE Expression of the Arabidopsis thaliana BBX32 Gene in Soybean Increases Grain Yield JOURNAL PLoS ONE 7 (2), E30717 (2012) PUBMED 22363475 REFERENCE 2 (bases 1 to 11397) AUTHORS Preuss SB. TITLE Direct Submission REFERENCE 3 (bases 1 to 11397) TITLE Direct Submission REFERENCE 4 (bases 1 to 11397) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "2"; pages: "E30717" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-JUL-2011) Yield " SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11397 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 295..639 /label="CaMV 35S promoter" /note="strong constitutive promoter from cauliflower mosaic virus" misc_feature 680..1164 /label="derived from G. max BBX52 suppression element" /note="derived from G. max BBX52 suppression element" 3'UTR 1203..1638 /label="derived from G. barbadense E6" /note="derived from G. barbadense E6" misc_feature complement(1937..1961) /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" CDS 3337..3525 /label="rop" /note="Rop protein, which maintains plasmids at low copy number" misc_feature 3630..3770 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(3956..4544) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 5075..5963 /label="derived from E. coli aadA" /note="derived from E. coli aadA" CDS 5117..5905 /codon_start=1 /gene="aadA" /product="aminoglycoside adenylyltransferase (Murphy, 1985)" /label="SmR" /note="confers resistance to spectinomycin and streptomycin" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" misc_feature 6214..6238 /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" terminator complement(6485..7126) /label="E9 terminator" /note="terminator and polyadenylation signal from the pea rbcS-E9 gene" CDS complement(7136..8500) /gene="aroA" /label="3-phosphoshikimate 1-carboxyvinyltransferase" /note="3-phosphoshikimate 1-carboxyvinyltransferase from Agrobacterium sp. (strain CP4). Accession#: Q9R4E4" CDS complement(8501..8728) /codon_start=1 /product="EPSPS CTP" /label="EPSPS CTP" /note="derived from A. thaliana ShkG" /protein_id="AEP17827.1" /translation="MAQVSRICNGVQNPSLISNLSKSSQRKSPLSVSLKTQQHPRAYPI SSSWGLKKSGMTLIGSELRPLKVMSSVSTAC" 5'UTR complement(8738..9405) /label="derived from A. thaliana Tsf1" /note="derived from A. thaliana Tsf1" regulatory complement(9406..9885) /label="derived from A. thaliana Tsf1" /note="derived from A. thaliana Tsf1" /regulatory_class="promoter" regulatory complement(9909..10445) /label="FMV 35S" /note="FMV 35S" /regulatory_class="enhancer" misc_feature 10508..10532 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA" misc_feature complement(11288..11312) /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.