Basic Vector Information
- Vector Name:
- pMON82053
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9769 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
- Promoter:
- CaMV 35S
pMON82053 vector Map
pMON82053 vector Sequence
LOCUS V004680 9769 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004680 VERSION V004680 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9769) AUTHORS Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME. TITLE Expression of the Arabidopsis thaliana BBX32 Gene in Soybean Increases Grain Yield JOURNAL PLoS ONE 7 (2), E30717 (2012) PUBMED 22363475 REFERENCE 2 (bases 1 to 9769) AUTHORS Preuss SB. TITLE Direct Submission REFERENCE 3 (bases 1 to 9769) TITLE Direct Submission REFERENCE 4 (bases 1 to 9769) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "2"; pages: "E30717" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-JUL-2011) Yield " SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9769 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 271..615 /label="CaMV 35S promoter" /note="strong constitutive promoter from cauliflower mosaic virus" 3'UTR 688..1002 /label="derived from G. barbadense E6" /note="derived from G. barbadense E6" misc_feature 1073..1097 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA" misc_feature complement(1526..2414) /label="derived from E. coli aadA" /note="derived from E. coli aadA" CDS complement(1584..2372) /codon_start=1 /gene="aadA" /product="aminoglycoside adenylyltransferase (Murphy, 1985)" /label="SmR" /note="confers resistance to spectinomycin and streptomycin" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 2945..3533 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(3719..3859) /label="bom" /note="basis of mobility region from pBR322" CDS complement(3964..4152) /label="rop" /note="Rop protein, which maintains plasmids at low copy number" rep_origin 5420..6133 /label="oriV" /note="incP origin of replication" misc_feature 6299..6323 /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" regulatory 6624..7223 /label="derived from A. thaliana Act7" /note="derived from A. thaliana Act7" /regulatory_class="promoter" 5'UTR 7224..7861 /label="derived from A. thaliana Act7" /note="derived from A. thaliana Act7" CDS 7864..8091 /codon_start=1 /product="EPSPS CTP" /label="EPSPS CTP" /note="derived from A. thaliana ShkG" /protein_id="AEP17835.1" /translation="MAQVSRICNGVQNPSLISNLSKSSQRKSPLSVSLKTQQHPRAYPI SSSWGLKKSGMTLIGSELRPLKVMSSVSTAC" CDS 8092..9456 /gene="aroA" /label="3-phosphoshikimate 1-carboxyvinyltransferase" /note="3-phosphoshikimate 1-carboxyvinyltransferase from Agrobacterium sp. (strain CP4). Accession#: Q9R4E4" terminator 9466..9718 /label="NOS terminator" /note="nopaline synthase terminator and poly(A) signal"
This page is informational only.