pMMS vector (V004693)

LOCUS       40924_31155        8367 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pMMS, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8367)
  AUTHORS   Tao F, Liu Y, Luo Q, Su F, Xu Y, Li F, Yu B, Ma C, Xu P.
  TITLE     Novel organic solvent-responsive expression vectors for 
            biocatalysis: application for development of an organic 
            solvent-tolerant biodesulfurizing strain
  JOURNAL   Bioresour. Technol. 102 (20), 9380-9387 (2011)
  PUBMED    21875790
REFERENCE   2  (bases 1 to 8367)
  AUTHORS   Tao F.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-AUG-2010) School of Life Sciences and Biotechnology, 
            Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai, 
            Shanghai 200240, China
REFERENCE   3  (bases 1 to 8367)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8367)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Bioresour. 
            Technol."; date: "2011"; volume: "102"; issue: "20"; pages: 
            "9380-9387"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (31-AUG-2010) School of Life Sciences and Biotechnology, Shanghai 
            Jiao Tong University, 800 Dongchuan Road, Shanghai, Shanghai 200240,
            China"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8367
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      236..322
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      414..441
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        460..551
                     /label=AmpR promoter
     CDS             552..1409
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      complement(1849..2243)
                     /direction=LEFT
                     /label=RSF1010 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     RSF1010; requires the RSF1010 RepA/B/C proteins for 
                     replication (Scholz et al., 1989)"
     CDS             complement(2270..2554)
                     /codon_start=1
                     /gene="mobC"
                     /product="MobC"
                     /label=mobC
                     /note="mobilization protein C"
                     /protein_id="AEM76688.1"
                     /translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK
                     VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
     gene            complement(2270..2554)
                     /gene="mobC"
                     /label=mobC
     oriT            2585..2672
                     /label=RSF1010 oriT
                     /note="origin of transfer of the broad-host-range plasmid 
                     RSF1010 (Scholz et al., 1989)"
     CDS             3501..3914
                     /codon_start=1
                     /gene="mobB"
                     /product="MobB"
                     /label=mobB
                     /note="mobilization protein B"
                     /protein_id="AEM76690.1"
                     /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS
                     EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
                     MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
     gene            3501..3914
                     /gene="mobB"
                     /label=mobB
     CDS             3911..4879
                     /label=RSF1010 RepB
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             5393..6229
                     /label=RSF1010 RepA
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             6219..7067
                     /label=RSF1010 RepC
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     regulatory      8274..8313
                     /gene="Psrp"
                     /label=organic solvent responsive promoter
                     /note="organic solvent responsive promoter"
                     /regulatory_class="promoter"
     gene            8274..8313
                     /gene="Psrp"
                     /label=Psrp