Basic Vector Information
- Vector Name:
- pMMRS
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10047 bp
- Type:
- Expression vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Tao F, Liu Y, Luo Q, Su F, Xu Y, Li F, Yu B, Ma C, Xu P.
pMMRS vector Map
pMMRS vector Sequence
LOCUS 40924_31150 10047 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pMMRS, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10047) AUTHORS Tao F, Liu Y, Luo Q, Su F, Xu Y, Li F, Yu B, Ma C, Xu P. TITLE Novel organic solvent-responsive expression vectors for biocatalysis: application for development of an organic solvent-tolerant biodesulfurizing strain JOURNAL Bioresour. Technol. 102 (20), 9380-9387 (2011) PUBMED 21875790 REFERENCE 2 (bases 1 to 10047) AUTHORS Tao F. TITLE Direct Submission JOURNAL Submitted (31-AUG-2010) School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai, Shanghai 200240, China REFERENCE 3 (bases 1 to 10047) TITLE Direct Submission REFERENCE 4 (bases 1 to 10047) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Bioresour. Technol."; date: "2011"; volume: "102"; issue: "20"; pages: "9380-9387" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-AUG-2010) School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai, Shanghai 200240, China" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10047 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 236..322 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 414..441 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 460..551 /label=AmpR promoter CDS 552..1409 /label=AmpR /note="beta-lactamase" rep_origin complement(1849..2243) /direction=LEFT /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" CDS complement(2270..2554) /codon_start=1 /gene="mobC" /product="MobC" /label=mobC /note="mobilization protein C" /protein_id="AEM76696.1" /translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG" gene complement(2270..2554) /gene="mobC" /label=mobC oriT 2585..2672 /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 3501..3914 /codon_start=1 /gene="mobB" /product="MobB" /label=mobB /note="mobilization protein B" /protein_id="AEM76698.1" /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR" gene 3501..3914 /gene="mobB" /label=mobB CDS 3911..4879 /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 5393..6229 /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 6219..7067 /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(7954..8595) /codon_start=1 /gene="srpR" /product="SrpR" /label=srpR /note="regulator of promoter Psrp" /protein_id="AEM76702.1" /translation="MARKTAAEAEETRQRIIDAALEVFVAQGVSDATLDQIARKAGVTR GAVYWHFNGKLEVLQAVLASRQHPLELDFTPDLGIERSWEAVVVAMLDAVHSPQSKQFS EILIYQGLDESGLIHNRMVQASDRFLQYIHQVLRHAVTQGELPINLDLQTSIGVFKGLI TGLLYEGLRSKDQQAQIIKVALGSFWALLREPPRFLLCEEAQIKQVKSFE" gene complement(7954..8595) /gene="srpR" /label=srpR CDS complement(8601..9380) /codon_start=1 /gene="srpS" /product="SrpS" /label=srpS /note="regulator of promoter Psrp" /protein_id="AEM76703.1" /translation="MNQSDENVGKAGGIQVIARAASIMRALGSHPHGLSLAAIAQLVGL PRSTVQRIINALEEEFLVEALGPAGGFRLGPALGQLINQAQSDILSLVKPYLRSLAEEL EESVCLASLAGDKIYVLDRIVSERELRVVFPIGINVPAAATAAGKVLLAALPDETLQAA LGEQLPVFTSNTLRRKALVKQLSEVRQSGFASDLDEHIDGVCSFATLLDTYLGYYSLAV VMPSSRASKQSDLIKKALLQSKQNIERAIGRASKKAP" gene complement(8601..9380) /gene="srpS" /label=srpS promoter complement(9613..9690) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." regulatory 9954..10003 /gene="Psrp" /regulatory_class="promoter" gene 9954..10003 /gene="Psrp" /label=Psrp
This page is informational only.