pMM25 vector (V004696)

Download GeneBank File(.gb)

LOCUS       40924_31135        4266 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Saccharomyces cerevisiae vector pMM25, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4266)
  AUTHORS   Moscariello MM, Sutherland BM.
  TITLE     Transferring linear DNA fragments in the yeast Saccharomyces 
            cerevisiae: A new in vivo eukaryotic system that reveals deleterious
            combinations of DNA cluster damage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4266)
  AUTHORS   Moscariello MM, Sutherland BM.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-SEP-2009) Biology, Brookhaven National Laboratory, 50 
            Bell Avenue, Upton, NY 11973, USA
REFERENCE   3  (bases 1 to 4266)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4266)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (22-SEP-2009) Biology, Brookhaven National Laboratory, 50 Bell 
            Avenue, Upton, NY 11973, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4266
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(3..458)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        626..644
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     670..686
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     gene            713..1659
                     /gene="ADE2"
                     /label=ADE2
     regulatory      713..885
                     /gene="ADE2"
                     /regulatory_class="promoter"
     CDS             886..1659
                     /codon_start=1
                     /gene="ADE2"
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /label=ADE2
                     /note="catalyzes a step in 'de novo' purine nucleotide 
                     biosynthetic pathway"
                     /protein_id="ACX71835.1"
                     /translation="MDSRTVGILGGGQLGRMIVEAANRLNIKTVILDAENSPAKQISNS
                     NDHVNGSFSNPLDIEKLAEKCDVLTIEIEHVDVPTLKNLQVKHPKLKIYPSPETIRLIQ
                     DKYIQKEHLIKNGIAVTQSVPVEQASETSLLNVGRDLGFPFVLKSRTLAYDGRGNFVVK
                     NKEMIPEALEVLKDRPLYAEKWAPFTKELAVMIVRSVNGLVFSYPIVETIHKDNICDLC
                     YAPARVPDSVQLKAKLLAENAIKSFPGCGIFGVEMF"
     promoter        1812..1999
                     /label=HIS3 promoter
     CDS             2000..2018
                     /codon_start=1
                     /gene="HIS3"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /label=HIS3
                     /note="catalyzes the sixth step in histidine biosynthesis"
                     /protein_id="ACX71836.1"
                     /translation="MRQSRK"
     primer_bind     complement(2025..2041)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(2078..2096)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(2117..2133)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(2141..2157)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2165..2195)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(2210..2231)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(2519..3107)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3281..4138)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(4139..4243)
                     /label=AmpR promoter