pMLS7 vector (V004702)

Basic Vector Information

Vector Name:
pMLS7
Antibiotic Resistance:
Trimethoprim
Length:
6124 bp
Type:
Broad host range vector
Replication origin:
pBBR1 oriV
Source/Author:
Lefebre MD, Valvano MA.

pMLS7 vector Vector Map

pMLS76124 bp30060090012001500180021002400270030003300360039004200450048005100540057006000cat promoterMobpBBR1 oriVpBBR1 RepTpRPc promoterSmall ribosomal subunit protein uS12multiple cloning site; EcoRI to HindIIIrrnB T1 terminatorrrnB T2 terminator

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pMLS7 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V004702                 6124 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004702
VERSION     V004702
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6124)
  AUTHORS   Lefebre MD, Valvano MA.
  TITLE     Construction and evaluation of plasmid vectors optimized for
            constitutive and regulated gene expression in Burkholderia cepacia
            complex isolates
  JOURNAL   Appl. Environ. Microbiol. 68 (12), 5956-5964 (2002)
   PUBMED   12450816
REFERENCE   2  (bases 1 to 6124)
  AUTHORS   Lefebre MD, Valvano MA.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAY-2002) Microbiology and Immunology, University of
            Western Ontario, Dental Sciences Building Rm 3000, London, ONT N6A
            5C1, Canada
REFERENCE   3  (bases 1 to 6124)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6124)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol."; date: "2002"; volume: "68"; issue: "12";
            pages: "5956-5964"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (15-MAY-2002) Microbiology and Immunology, University of Western
            Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 5C1,
            Canada"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6124
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        complement(836..938)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             complement(1088..2107)
                     /codon_start=1
                     /gene="mob"
                     /product="Mob"
                     /function="required for plasmid mobilization"
                     /label="mob"
                     /protein_id="AAM63386.1"
                     /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW
                     AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA
                     DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA
                     DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR
                     VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP
                     LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS"
     gene            complement(1088..2107)
                     /gene="mob"
                     /label="mob"
     rep_origin      2331..3100
                     /label="pBBR1 oriV"
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1
                     Rep protein for replication"
     CDS             3101..3760
                     /label="pBBR1 Rep"
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"
     CDS             complement(4218..4451)
                     /label="TpR"
                     /note="E. coli plasmid-associated dihydrofolate reductase"
     promoter        complement(4778..4806)
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label="Pc promoter"
                     /note="class 1 integron promoter"
     CDS             5069..5446
                     /gene="rpsL"
                     /label="Small ribosomal subunit protein uS12"
                     /note="Small ribosomal subunit protein uS12 from
                     Paraburkholderia xenovorans (strain LB400). Accession#:
                     Q13TG5"
     misc_feature    5642..5697
                     /note="multiple cloning site; EcoRI to HindIII"
     terminator      5900..5986
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      6078..6105
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"

This page is informational only.