Basic Vector Information
- Vector Name:
- pMLS7
- Antibiotic Resistance:
- Trimethoprim
- Length:
- 6124 bp
- Type:
- Broad host range vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Lefebre MD, Valvano MA.
pMLS7 vector Map
pMLS7 vector Sequence
LOCUS V004702 6124 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004702 VERSION V004702 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6124) AUTHORS Lefebre MD, Valvano MA. TITLE Construction and evaluation of plasmid vectors optimized for constitutive and regulated gene expression in Burkholderia cepacia complex isolates JOURNAL Appl. Environ. Microbiol. 68 (12), 5956-5964 (2002) PUBMED 12450816 REFERENCE 2 (bases 1 to 6124) AUTHORS Lefebre MD, Valvano MA. TITLE Direct Submission JOURNAL Submitted (15-MAY-2002) Microbiology and Immunology, University of Western Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 5C1, Canada REFERENCE 3 (bases 1 to 6124) TITLE Direct Submission REFERENCE 4 (bases 1 to 6124) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2002"; volume: "68"; issue: "12"; pages: "5956-5964" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-MAY-2002) Microbiology and Immunology, University of Western Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 5C1, Canada" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6124 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(836..938) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS complement(1088..2107) /codon_start=1 /gene="mob" /product="Mob" /function="required for plasmid mobilization" /label="mob" /protein_id="AAM63386.1" /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS" gene complement(1088..2107) /gene="mob" /label="mob" rep_origin 2331..3100 /label="pBBR1 oriV" /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 3101..3760 /label="pBBR1 Rep" /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" CDS complement(4218..4451) /label="TpR" /note="E. coli plasmid-associated dihydrofolate reductase" promoter complement(4778..4806) /gene="intI1 (promoter lies within the coding sequence)" /label="Pc promoter" /note="class 1 integron promoter" CDS 5069..5446 /gene="rpsL" /label="Small ribosomal subunit protein uS12" /note="Small ribosomal subunit protein uS12 from Paraburkholderia xenovorans (strain LB400). Accession#: Q13TG5" misc_feature 5642..5697 /note="multiple cloning site; EcoRI to HindIII" terminator 5900..5986 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 6078..6105 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene"
This page is informational only.