pMLBAD vector (V004705)

LOCUS       40924_31090        6775 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Broad host range vector pMLBAD, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6775)
  AUTHORS   Lefebre MD, Valvano MA.
  TITLE     Construction and evaluation of plasmid vectors optimized for 
            constitutive and regulated gene expression in Burkholderia cepacia 
            complex isolates
  JOURNAL   Appl. Environ. Microbiol. 68 (12), 5956-5964 (2002)
  PUBMED    12450816
REFERENCE   2  (bases 1 to 6775)
  AUTHORS   Lefebre MD, Valvano MA.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAY-2002) Microbiology and Immunology, University of 
            Western Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 
            5C1, Canada
REFERENCE   3  (bases 1 to 6775)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6775)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2002"; volume: "68"; issue: "12"; 
            pages: "5956-5964"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (15-MAY-2002) Microbiology and Immunology, University of Western 
            Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 5C1, 
            Canada"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6775
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        55..83
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     CDS             410..643
                     /label=TpR
                     /note="E. coli plasmid-associated dihydrofolate reductase"
     CDS             complement(872..1747)
                     /label=araC
                     /note="L-arabinose regulatory protein"
     promoter        1774..2058
                     /label=araBAD promoter
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite 
                     direction (Guzman et al., 1995)"
     misc_feature    2084..2139
                     /note="multiple cloning site; EcoRI to HindIII"
     terminator      2342..2428
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2520..2547
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        complement(3402..3504)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             complement(3654..4673)
                     /codon_start=1
                     /gene="mob"
                     /product="Mob"
                     /function="required for plasmid mobilization"
                     /label=mob
                     /protein_id="AAM63383.1"
                     /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW
                     AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA
                     DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA
                     DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR
                     VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP
                     LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS"
     gene            complement(3654..4673)
                     /gene="mob"
                     /label=mob
     rep_origin      4897..5666
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
     CDS             5667..6326
                     /label=pBBR1 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"