Basic Vector Information
- Vector Name:
- pMKEx2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8061 bp
- Type:
- Shuttle-expression vector
- Replication origin:
- p15A ori
- Source/Author:
- Kortmann M, Kuhl V, Klaffl S, Bott M.
pMKEx2 vector Map
pMKEx2 vector Sequence
LOCUS 40924_31045 8061 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle-expression vector pMKEx2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8061) AUTHORS Kortmann M, Kuhl V, Klaffl S, Bott M. TITLE A chromosomally encoded T7 RNA polymerase-dependent gene expression system for Corynebacterium glutamicum: construction and comparative evaluation at the single-cell level JOURNAL Microb Biotechnol (2014) In press PUBMED 25488698 REFERENCE 2 (bases 1 to 8061) AUTHORS Kortmann M, Kuhl V, Klaffl S, Bott M. TITLE Direct Submission JOURNAL Submitted (25-SEP-2014) IBG-1: Biotechnology, Forschungszentrum Juelich GmbH, Wilhelm-Johnen-Strasse, Juelich 52425, Germany REFERENCE 3 (bases 1 to 8061) TITLE Direct Submission REFERENCE 4 (bases 1 to 8061) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microb Biotechnol (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-SEP-2014) IBG-1: Biotechnology, Forschungszentrum Juelich GmbH, Wilhelm-Johnen-Strasse, Juelich 52425, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8061 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(73..120) /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(160..186) /codon_start=1 /label=9xHis /note="9xHis affinity tag" /translation="HHHHHHHHH" CDS complement(193..210) /codon_start=1 /label=thrombin site /note="thrombin recognition and cleavage site" /translation="LVPRGS" CDS complement(256..279) /codon_start=1 /label=HRV 3C site /note="recognition and cleavage site for human rhinovirus 3C and PreScission proteases" /translation="LEVLFQGP" CDS complement(286..309) /codon_start=1 /label=Strep-Tag II /note="peptide that binds Strep-Tactin(R), an engineered form of streptavidin" /translation="WSHPQFEK" RBS complement(325..347) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" protein_bind complement(362..386) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(387..405) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 718..795 /label=lacI promoter CDS 796..1875 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 1891..1912 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 2451..2996 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS 3591..4403 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" CDS complement(5380..6837) /codon_start=1 /gene="repA" /product="replicase" /label=repA /protein_id="AIZ68604.1" /translation="MTLADSRDIDTPAWKFSADLFDTHPELALRSRGWTSEDRREFLAH LGRENFQGSKTRDFASAWIKDPDTGETQPKLYRVGSKSLARCQYVALTHAQHAAVLVLD IDVPSHQAGGKIEHVNPEVYAILERWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAAAG MSSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYRWHAQHNRVDRLADL MEVARMISGTEKPKKRYEQEFSSGRARIEAARKATAEAKALATLEASLPSAAEASGELI DGVRVLWTAPGRAARDETAFRHALTVGYQLKAAGERLKDTKIIDAYERAYTVAQAVGAD GREPDLPPMRDRQTMARRVRGYVAKGQPVVPARQTETQSSRGRKALATMGRRGGKKAAE RWKDPNSEYARAQREKLAKSSQRQARKAKGNRLTIAGWFMTVEGETGSWPTINEAMSEF SVSRQTVNRALKSAGIELPRGRRKASQ" gene complement(5380..6837) /gene="repA" /label=repA
This page is informational only.