Basic Vector Information
- Vector Name:
- pMK4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5585 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Zeigler DR.
pMK4 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMK4 vector Sequence
LOCUS V004712 5585 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004712 VERSION V004712 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5585) AUTHORS Zeigler DR. TITLE pMK3 and pMK4 revisited: nucleotide sequences of first generation Bacillus subtilis - E. coli shuttle vectors JOURNAL Unpublished REFERENCE 2 (bases 1 to 5585) AUTHORS Zeigler DR. TITLE Direct Submission JOURNAL Submitted (06-MAR-2008) Bacillus Genetic Stock Center, The Ohio State University, 484 W 12th Ave, Columbus, OH 43210, USA REFERENCE 3 (bases 1 to 5585) TITLE Direct Submission REFERENCE 4 (bases 1 to 5585) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAR-2008) Bacillus Genetic Stock Center, The Ohio State University, 484 W 12th Ave, Columbus, OH 43210, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5585 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 106..127 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 142..172 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 180..196 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 204..220 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" primer_bind complement(269..285) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 759..863 /label="AmpR promoter" CDS 864..1721 /label="AmpR" /note="beta-lactamase" CDS complement(2460..2474) /label="enterokinase site" /note="enterokinase recognition and cleavage site" CDS complement(2572..3507) /codon_start=1 /gene="repC" /product="replication initiation protein" /label="repC" /note="RepC; initiation of plasmid replication; derived from Staphylococcus aureus plasmid pC194" /protein_id="ACB41735.1" /translation="MCYNMEKYTEKKQRNQVFQKFIKRHIGENQMDLVEDCNTFLSFVA DKTLEKQKLYKANSCKNRFCPVCAWRKARKDALGLSLMMQYIKQQEKKEFIFLTLTTPN VMSDELENEIKRYNNSFRKLIKRKKVGSVIKGYVRKLEITYNKKRDDYNPHFHVLIAVN KSYFTDKRYYISQQEWLDLWRDVTGISEITQVQVQKIRQNNNKELYEMAKYSGKDSDYL INQKVFDAFYKSLKGKQVLVYSGLFKEAKKKLKNGDLDYLKEIDPTEYIYQIFYIWKQK EYLASELYDLTEQEKREINHKMIDEIEEEQ" gene complement(2572..3507) /gene="repC" /label="repC" CDS 3965..4612 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" rep_origin 4815..5403 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.