pMK33-CTAP vector (V004715)

Download GeneBank File(.gb)

LOCUS       40924_30985        8793 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pMK33-CTAP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8793)
  AUTHORS   Veraksa A, Bauer A, Artavanis-Tsakonas S.
  TITLE     Analyzing protein complexes in Drosophila with tandem affinity 
            purification-mass spectrometry
  JOURNAL   Dev. Dyn. 232 (3), 827-834 (2005)
  PUBMED    15704125
REFERENCE   2  (bases 1 to 8793)
  AUTHORS   Veraksa A, Bauer A, Artavanis-Tsakonas S.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-AUG-2004) MGH Cancer Center, Harvard Medical School, 
            Bldg 149, 13th Street, Charlestown, MA 02129, USA
REFERENCE   3  (bases 1 to 8793)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8793)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Dev. Dyn.";
            date: "2005"; volume: "232"; issue: "3"; pages: "827-834"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (17-AUG-2004) MGH Cancer Center, Harvard Medical School, Bldg 149, 
            13th Street, Charlestown, MA 02129, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8793
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..8
                     /label=NotI site
                     /note="NotI site"
     rep_origin      complement(865..1453)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1627..2484)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(2485..2589)
                     /label=AmpR promoter
     promoter        4071..4350
                     /label=copia promoter
                     /note="strong promoter from the Drosophila transposable
                     element copia (Sinclair et al., 1986)"
     CDS             4396..5418
                     /label=HygR
                     /note="aminoglycoside phosphotransferase from E. coli"
     intron          5784..5849
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             5979..5999
                     /label=SV40 NLS
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     polyA_signal    6424..6558
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     promoter        6559..6985
                     /label=MT promoter
                     /note="Drosophila metallothionein promoter"
     misc_feature    6992..7015
                     /note="polylinker; unique cloning sites for XhoI, BamHI,
                     EcoRV, SpeI"
     CDS             7022..7099
                     /label=CBP
                     /note="calmodulin-binding peptide"
     CDS             7127..7147
                     /label=TEV site
                     /note="tobacco etch virus (TEV) protease recognition and 
                     cleavage site"
     CDS             7187..7360
                     /label=ProtA
                     /note="IgG-binding unit of Staphylococcus aureus protein A"
     CDS             7364..7534
                     /codon_start=1
                     /product="IgG-binding unit of Staphylococcus aureus protein
                     A"
                     /label=ProtA
                     /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLA
                     EAKKLNGAQAPK"