Basic Vector Information
- Vector Name:
- pMK2017
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4252 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- House BL, Mortimer MW, Kahn ML.
- Promoter:
- lac UV5
pMK2017 vector Vector Map
pMK2017 vector Sequence
LOCUS 40924_30960 4252 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMK2017, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4252) AUTHORS House BL, Mortimer MW, Kahn ML. TITLE New recombination methods for Sinorhizobium meliloti genetics JOURNAL Appl. Environ. Microbiol. 70 (5), 2806-2815 (2004) PUBMED 15128536 REFERENCE 2 (bases 1 to 4252) AUTHORS House BL, Mortimer MW, Kahn ML. TITLE Direct Submission JOURNAL Submitted (29-SEP-2003) School of Molecular Biosciences, Washington State University, Abelson Hall Room 406A, Pullman, WA 99164, USA REFERENCE 3 (bases 1 to 4252) TITLE Direct Submission REFERENCE 4 (bases 1 to 4252) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2004"; volume: "70"; issue: "5"; pages: "2806-2815" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-SEP-2003) School of Molecular Biosciences, Washington State University, Abelson Hall Room 406A, Pullman, WA 99164, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4252 /mol_type="other DNA" /organism="synthetic DNA construct" oriT complement(93..202) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 373..761 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" misc_feature 772..877 /label=MCS /note="pBluescript multiple cloning site" protein_bind 898..945 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." protein_bind 1003..1122 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1152..1182 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1236..1892 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2237..2539 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2583..2707) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" protein_bind complement(2765..2812) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." CDS complement(2958..4145) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVLFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
This page is informational only.