Basic Vector Information
- Vector Name:
- pMK2010
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4892 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- House BL, Mortimer MW, Kahn ML.
pMK2010 vector Map
pMK2010 vector Sequence
LOCUS 40924_30950 4892 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMK2010, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4892) AUTHORS House BL, Mortimer MW, Kahn ML. TITLE New recombination methods for Sinorhizobium meliloti genetics JOURNAL Appl. Environ. Microbiol. 70 (5), 2806-2815 (2004) PUBMED 15128536 REFERENCE 2 (bases 1 to 4892) AUTHORS House BL, Kahn ML. TITLE Direct Submission JOURNAL Submitted (29-SEP-2003) School of Molecular Biosciences, Washington State University, Abelson Hall Room 406A, Pullman, WA 99164, USA REFERENCE 3 (bases 1 to 4892) TITLE Direct Submission REFERENCE 4 (bases 1 to 4892) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2004"; volume: "70"; issue: "5"; pages: "2806-2815" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-SEP-2003) School of Molecular Biosciences, Washington State University, Abelson Hall Room 406A, Pullman, WA 99164, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4892 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 29..260 /label=attP1 /note="recombination site for the Gateway(R) BP reaction" CDS complement(659..961) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(1306..1962) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(1963..2065) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind complement(2210..2441) /label=attP2 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" CDS 2565..3371 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3517..4105 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" oriT 4348..4457 /label=oriT /note="incP origin of transfer" terminator complement(4662..4689) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(4781..4867) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.