Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V004730 | pMID21 | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
The pMID21 is derived from pCES119 where the Fab-display cassette has been replaced with a cassette nearly identical to that of DY3F63. The iii(stump) of pMID21 is flanked by two MluI sites. MluI digestion and religation removes iii(stump), allowing the expression of soluble Fab fragments in E. coli.
- Vector Name:
- pMID21
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5960 bp
- Type:
- Phagemid vector
- Replication origin:
- ori
- Source/Author:
- Hoet RM, Coehn EH, Kent RB, Rookey K, Schoonbroodt S, Hogan S, Rem L, Frans N, Daukandt M, Pieters H, van Hegelsom R, Coolen-van Neer N, Nastri HG, Rondon IJ, Leeds J, Hufton SE, Huang L, Kashin I, De
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pMID21 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Hoet RM, Cohen EH, Kent RB, et al. Generation of high-affinity human antibodies by combining donor-derived and synthetic complementarity-determining-region diversity. Nat Biotechnol. 2005;23(3):344-348. doi:10.1038/nbt1067
- Wassaf D, Kuang G, Kopacz K, et al. High-throughput affinity ranking of antibodies using surface plasmon resonance microarrays. Anal Biochem. 2006;351(2):241-253. doi:10.1016/j.ab.2006.01.043
- Kenniston JA, Faucette RR, Martik D, Comeau SR, Lindberg AP, Kopacz KJ, Conley GP, Chen J, Viswanathan M, Kastrapeli N, Cosic J, Mason S, DiLeo M, Abendroth J, Kuzmic P, Ladner RC, Edwards TE, TenHoor C, Adelman BA, Nixon AE, Sexton DJ. Inhibition of plasma kallikrein by a highly specific active site blocking antibody. J Biol Chem. 2014 Aug 22;289(34):23596-608. doi: 10.1074/jbc.M114.569061. Epub 2014 Jun 26. PMID: 24970892; PMCID: PMC4156074.
pMID21 vector Sequence
LOCUS Exported 5960 bp DNA circular SYN 07-MAY-2025
DEFINITION Phagemid vector pMID21, complete sequence.
ACCESSION .
VERSION .
KEYWORDS pMID21 vector (V004730)
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5960)
AUTHORS Hoet RM, Coehn EH, Kent RB, Rookey K, Schoonbroodt S, Hogan S, Rem
L, Frans N, Daukandt M, Pieters H, van Hegelsom R, Coolen-van Neer
N, Nastri HG, Rondon IJ, Leeds J, Hufton SE, Huang L, Kashin I,
Devlin M, Kuang G, Steukers M, Viswanathan M, Nixon AE, Sexton DJ,
Hoogenboom HR, Ladner RC.
TITLE Generation of high-affinity human antibodies by combining
donor-derived and synthetic complementarity-determining-region
diversity
JOURNAL Nat. Biotechnol. 23 (3), 344-348 (2005)
PUBMED 15723048
REFERENCE 2 (bases 1 to 5960)
AUTHORS Ladner RC, Hoogenboom HR, Hoet RM, Cohen EH, Kashin I, Rondon IJ,
Rem L, Frans N, Schoonbroodt S, Kent RB, Rookey K, Hogan S.
TITLE Direct Submission
JOURNAL Submitted (13-SEP-2004) Research, Dyax Corp, 300 Technology Square,
Cambridge, MA 02139, USA
REFERENCE 3 (bases 1 to 5960)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5960)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 5960)
TITLE Direct Submission
REFERENCE 6 (bases 1 to 5960)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat.
Biotechnol."; date: "2005"; volume: "23"; issue: "3"; pages:
"344-348"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-SEP-2004) Research, Dyax Corp, 300 Technology Square, Cambridge,
MA 02139, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT SGRef: number: 4; type: "Journal Article"
COMMENT SGRef: number: 5; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5960
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 96..200
/label=AmpR promoter
CDS 201..1058
/label=AmpR
/note="beta-lactamase"
rep_origin 1232..1820
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 2108..2129
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2144..2174
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 2182..2198
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2206..2222
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 2269..2325
/codon_start=1
/note="encodes light chain signal sequence; antibody
stuffer"
/translation="VKKLLFAIPLVVPFYSHSA"
misc_feature 2326..2352
/label=encodes light chain antibody stuffer
/note="encodes light chain antibody stuffer"
CDS 2365..2682
/label=hIg-kappa-CL
/note="Human immunoglobulin kappa light chain constant
region"
CDS 2726..2788
/codon_start=1
/label=heavy chain signal
/note="encodes heavy chain signal sequence; antibody
stuffer"
/translation="MKKLLFMIPLVVPFVAQPASA"
misc_feature 2867..3766
/label=encodes heavy chain antibody stuffer
/note="encodes heavy chain antibody stuffer"
CDS 4516..4533
/label=6xHis
/note="6xHis affinity tag"
CDS 4543..4572
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
CDS 4612..5070
/codon_start=1
/label=M13 gene III
/translation="SGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAI
DGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFV
FGAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES"
primer_bind complement(5092..5108)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin complement(5304..5759)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"