Basic Vector Information
- Vector Name:
- pMGK
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5363 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Boel G, Letso R, Neely H, Price WN, Wong KH, Su M, Luff JD, Valecha M, Everett JK, Acton TB, Xiao R, Montelione GT, Aalberts DP, Hunt JF.
pMGK vector Vector Map
pMGK vector Sequence
LOCUS 40924_30790 5363 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMGK, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5363) AUTHORS Boel G, Letso R, Neely H, Price WN, Wong KH, Su M, Luff JD, Valecha M, Everett JK, Acton TB, Xiao R, Montelione GT, Aalberts DP, Hunt JF. TITLE Codon influence on protein expression in E. coli correlates with mRNA levels JOURNAL Nature 529, 358-363 (2016) PUBMED 26760206 REFERENCE 2 (bases 1 to 5363) AUTHORS Boel G, Hunt JF, Montelione GT, Acton T. TITLE Direct Submission JOURNAL Submitted (23-JUN-2015) Biological Sciences, Columbia University, 1212 Amsterdam Ave., New York, NY 10027, USA REFERENCE 3 (bases 1 to 5363) TITLE Direct Submission REFERENCE 4 (bases 1 to 5363) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nature 529, 358-363 (2016)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-JUN-2015) Biological Sciences, Columbia University, 1212 Amsterdam Ave., New York, NY 10027, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5363 /mol_type="other DNA" /organism="synthetic DNA construct" tRNA complement(893..969) /label=argU promoter 1694..1771 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 1772..2851 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 2867..2888 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." terminator 3056..3090 /label=lambda t0 terminator /note="minimal transcription terminator from phage lambda (Scholtissek and Grosse, 1987)" CDS complement(3802..4614) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin complement(join(5209..5363,1..391)) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin."
This page is informational only.