Basic Vector Information
- Vector Name:
- pMG14
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5169 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Gimpel M, Brantl S.
pMG14 vector Vector Map
pMG14 vector Sequence
LOCUS 40924_30765 5169 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMG14, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5169) AUTHORS Gimpel M, Brantl S. TITLE Construction of a modular plasmid family for chromosomal integration in Bacillus subtilis JOURNAL J. Microbiol. Methods 91 (2), 312-317 (2012) PUBMED 22982324 REFERENCE 2 (bases 1 to 5169) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 3 (bases 1 to 5169) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 4 (bases 1 to 5169) TITLE Direct Submission REFERENCE 5 (bases 1 to 5169) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods"; date: "2012"; volume: "91"; issue: "2"; pages: "312-317" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..5169 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 5..234 /label=cggR promoter /note="cggR promoter" /regulatory_class="promoter" misc_feature 262..302 /label=5' UTR of gapA /note="5' UTR of gapA" CDS 311..334 /label=Strep-Tag II /note="peptide that binds Strep-Tactin(R), an engineered form of streptavidin" CDS complement(470..1009) /codon_start=1 /note="unnamed protein product; amyE fragment" /protein_id="SJL86547.1" /translation="MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAP SIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQ PTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTH GNTQIKNWSDRWDVTQN" misc_feature complement(1010..1125) /label=5' UTR of amyE /note="5' UTR of amyE" promoter 1229..1333 /label=AmpR promoter CDS 1334..2191 /label=AmpR /note="beta-lactamase" rep_origin 2365..2953 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 3241..3262 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3277..3307 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3315..3331 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 3339..3355 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS complement(3396..4199) /codon_start=1 /note="unnamed protein product; amyE fragment" /protein_id="SJL86549.1" /translation="STWMSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGKSQI GDRGSALFEDQAITAVNRFHNVMAGQPEELSNPNGNNQIFMNQRGSHGVVLANAGSSSV SINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINARSVAVLYPDDIAKAPHVFLENYKT GVTHSFNDQLTITLRADANTTKAVYQINNGPETAFKDGDQFTIGKGDPFGKTYTIMLKG TNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQVNAYIYKHDGS" CDS complement(4289..5059) /codon_start=1 /note="unnamed protein product; kanamycin/tobramycin resistance (aadD)" /protein_id="SJL86550.1" /translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHG QFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTT FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSD SEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF"
This page is informational only.