pMG105 vector (V004748)

LOCUS       40924_30760        5680 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pMG105 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5680)
  AUTHORS   Inui M, Roh JH, Zahn K, Yukawa H.
  TITLE     Sequence analysis of the cryptic plasmid pMG101 from 
            Rhodopseudomonas palustris and construction of stable cloning 
            vectors
  JOURNAL   Appl. Environ. Microbiol. 66 (1), 54-63 (2000)
  PUBMED    10618203
REFERENCE   2  (bases 1 to 5680)
  AUTHORS   Inui M.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-AUG-1999) Masayuki Inui, Research Institute of 
            Innovative Technology for the Earth, Molecular Microbiology and 
            Genetics Laboratory; 9-2, Kizugawadai, Soraku, Kizu, Kyoto 619-0292,
            Japan (E-mail:inui@rite.or.jp, Tel:81-774-75-2308, 
            Fax:81-774-75-2321)
REFERENCE   3  (bases 1 to 5680)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5680)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2000"; volume: "66"; issue: "1"; pages:
            "54-63"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (16-AUG-1999) Masayuki Inui, Research Institute of Innovative 
            Technology for the Earth, Molecular Microbiology and Genetics 
            Laboratory"; volume: " 9-2, Kizugawadai, Soraku, Kizu, Kyoto 
            619-0292, Japan (E-mail:inui@rite.or.jp, Tel:81-774-75-2308, Fax"; 
            pages: "81-774-75-2321"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5680
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          1..27
                     /mol_type="other DNA"
                     /label=derived from cloning vector pHSG299
                     /note="derived from cloning vector pHSG299"
                     /db_xref="taxon:32630"
                     /organism="synthetic construct"
     source          28..3080
                     /plasmid="pMG101"
                     /mol_type="other DNA"
                     /label=derived from 3.0-kb XhoI-SalI fragment of pMG101
                     /note="derived from 3.0-kb XhoI-SalI fragment of pMG101"
                     /db_xref="taxon:1076"
                     /organism="Rhodopseudomonas palustris"
     CDS             3331..4143
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSKPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     primer_bind     4365..4381
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    4382..4438
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(4451..4467)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4475..4491)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4499..4529)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4544..4565)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5037..5625)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"