Basic Vector Information
- Vector Name:
- pME6041
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5604 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D.
pME6041 vector Vector Map
pME6041 vector Sequence
LOCUS 40924_30570 5604 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pME6041, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5604) AUTHORS Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D. TITLE Small, stable shuttle vectors based on the minimal pVS1 replicon for use in gram-negative, plant-associated bacteria JOURNAL Mol. Plant Microbe Interact. 13 (2), 232-237 (2000) PUBMED 10659714 REFERENCE 2 (bases 1 to 5604) AUTHORS Heeb S. TITLE Direct Submission JOURNAL Submitted (30-DEC-1998) Laboratoire de Biologie Microbienne, University of Lausanne, Batiment de Biologie, Lausanne CH-1015, Switzerland REFERENCE 3 (bases 1 to 5604) TITLE Direct Submission REFERENCE 4 (bases 1 to 5604) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Plant Microbe Interact."; date: "2000"; volume: "13"; issue: "2"; pages: "232-237" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-DEC-1998) Laboratoire de Biologie Microbienne, University of Lausanne, Batiment de Biologie, Lausanne CH-1015, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5604 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 195..821 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 845..1060 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="ORF3; not required for stable maintenance" /protein_id="AAD19691.1" /translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT KLKMYAVRQGKTITELLSEYIAQLPE" misc_feature 1091..1103 /label=KorB box /note="KorB box" CDS 1253..2323 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 2392..2586 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 2981..3526 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 3768..3789 /label=p15A origin of transfer /note="p15A origin of transfer" misc_difference 3836..4125 /label=region absent in pME6040 /note="region absent in pME6040" regulatory 3859..4125 /label=T4 transcription terminator /note="T4 transcription terminator" /regulatory_class="terminator" misc_feature 4127..4237 /label=multiple cloning site /note="multiple cloning site" CDS 4519..5331 /label=KanR /note="aminoglycoside phosphotransferase" misc_difference 5574..5584 /label=region absent in pME6040 /note="region absent in pME6040"
This page is informational only.