pME6041 vector (V004773)

LOCUS       40924_30570        5604 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pME6041, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5604)
  AUTHORS   Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, 
            O'Gara F, Haas D.
  TITLE     Small, stable shuttle vectors based on the minimal pVS1 replicon for
            use in gram-negative, plant-associated bacteria
  JOURNAL   Mol. Plant Microbe Interact. 13 (2), 232-237 (2000)
  PUBMED    10659714
REFERENCE   2  (bases 1 to 5604)
  AUTHORS   Heeb S.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-DEC-1998) Laboratoire de Biologie Microbienne, 
            University of Lausanne, Batiment de Biologie, Lausanne CH-1015, 
            Switzerland
REFERENCE   3  (bases 1 to 5604)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5604)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Plant 
            Microbe Interact."; date: "2000"; volume: "13"; issue: "2"; pages: 
            "232-237"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (30-DEC-1998) Laboratoire de Biologie Microbienne, University of 
            Lausanne, Batiment de Biologie, Lausanne CH-1015, Switzerland"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5604
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             195..821
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             845..1060
                     /codon_start=1
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /note="ORF3; not required for stable maintenance"
                     /protein_id="AAD19691.1"
                     /translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT
                     KLKMYAVRQGKTITELLSEYIAQLPE"
     misc_feature    1091..1103
                     /label=KorB box
                     /note="KorB box"
     CDS             1253..2323
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      2392..2586
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      2981..3526
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     misc_feature    3768..3789
                     /label=p15A origin of transfer
                     /note="p15A origin of transfer"
     misc_difference 3836..4125
                     /label=region absent in pME6040
                     /note="region absent in pME6040"
     regulatory      3859..4125
                     /label=T4 transcription terminator
                     /note="T4 transcription terminator"
                     /regulatory_class="terminator"
     misc_feature    4127..4237
                     /label=multiple cloning site
                     /note="multiple cloning site"
     CDS             4519..5331
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_difference 5574..5584
                     /label=region absent in pME6040
                     /note="region absent in pME6040"