Basic Vector Information
- Vector Name:
- pME6040
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5303 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D.
pME6040 vector Map
pME6040 vector Sequence
LOCUS 40924_30565 5303 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pME6040, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5303) AUTHORS Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D. TITLE Small, stable shuttle vectors based on the minimal pVS1 replicon for use in gram-negative, plant-associated bacteria JOURNAL Mol. Plant Microbe Interact. 13 (2), 232-237 (2000) PUBMED 10659714 REFERENCE 2 (bases 1 to 5303) AUTHORS Heeb S. TITLE Direct Submission JOURNAL Submitted (10-MAR-1999) Laboratoire de Biologie Microbienne, University of Lausanne, Batiment de Biologie, Lausanne CH-1015, Switzerland REFERENCE 3 (bases 1 to 5303) TITLE Direct Submission REFERENCE 4 (bases 1 to 5303) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Plant Microbe Interact."; date: "2000"; volume: "13"; issue: "2"; pages: "232-237" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-MAR-1999) Laboratoire de Biologie Microbienne, University of Lausanne, Batiment de Biologie, Lausanne CH-1015, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5303 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 195..821 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 845..1060 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="ORF3; not required for stable maintenance" /protein_id="AAD21674.1" /translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT KLKMYAVRQGKTITELLSEYIAQLPE" misc_feature 1091..1103 /label=KorB box /note="KorB box" CDS 1253..2323 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" rep_origin 2392..2586 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 2981..3526 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 3768..3789 /label=p15A origin of transfer /note="p15A origin of transfer" misc_feature 3837..3947 /label=multiple cloning site /note="multiple cloning site" CDS 4229..5041 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
This page is informational only.