Basic Vector Information
- Vector Name:
- pME6010
- Antibiotic Resistance:
- Tetracycline
- Length:
- 8270 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Blumer C, Heeb S, Pessi G, Haas D.
pME6010 vector Map
pME6010 vector Sequence
LOCUS 40924_30535 8270 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pME6010, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8270) AUTHORS Blumer C, Heeb S, Pessi G, Haas D. TITLE Global GacA-steered control of cyanide and exoprotease production in Pseudomonas fluorescens involves specific ribosome binding sites JOURNAL Proc. Natl. Acad. Sci. U.S.A. 96 (24), 14073-14078 (1999) PUBMED 10570200 REFERENCE 2 (bases 1 to 8270) AUTHORS Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D. TITLE Small, stable shuttle vectors based on the minimal pVS1 replicon for use in gram-negative, plant-associated bacteria JOURNAL Mol. Plant Microbe Interact. 13 (2), 232-237 (2000) PUBMED 10659714 REFERENCE 3 (bases 1 to 8270) AUTHORS Heeb S. TITLE Direct Submission JOURNAL Submitted (30-DEC-1998) Laboratoire de Biologie Microbienne, University of Lausanne, Batiment de Biologie, Lausanne CH-1015, Switzerland REFERENCE 4 (bases 1 to 8270) TITLE Direct Submission REFERENCE 5 (bases 1 to 8270) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "1999"; volume: "96"; issue: "24"; pages: "14073-14078" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Mol. Plant Microbe Interact."; date: "2000"; volume: "13"; issue: "2"; pages: "232-237" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (30-DEC-1998) Laboratoire de Biologie Microbienne, University of Lausanne, Batiment de Biologie, Lausanne CH-1015, Switzerland" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..8270 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 195..881 /codon_start=1 /product="pVS1 resolvase" /label=pVS1 resolvase /note="ORF1; not required for stable maintenance" /protein_id="AAD19676.1" /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE RQEEQA" CDS 878..1093 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="ORF2; not required for stable maintenance" /protein_id="AAD19677.1" /translation="MKPHQDGQDEPFFITEEIEAEMIAAGYVFEPPAHVSTVRLHEILA GLSDAKLAAWPASLAAEETERRRLKR" CDS 1180..1806 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 1830..2045 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="ORF3; not required for stable maintenance" /protein_id="AAD19679.1" /translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT KLKMYAVRQGKTITELLSEYIAQLPE" misc_feature 2076..2088 /label=KorB box /note="KorB box" CDS 2238..3308 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" rep_origin 3377..3571 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 4281..4826 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 5068..5089 /label=p15A origin of transfer /note="p15A origin of transfer" misc_feature 5450..5502 /label=multiple cloning site /note="multiple cloning site" CDS complement(6292..6939) /codon_start=1 /label=TetR /note="tetracycline resistance regulatory protein" /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD" CDS 7045..8241 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="VKPNIPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY GILLALYALVQFACAPVLGALSDRFGRRPILLVSLAGATVDYAIMATAPFLWVLYIGRI VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR "
This page is informational only.