Basic Vector Information
- Vector Name:
- pME-LifeAct-GFP
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3342 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hall TE, Currie PD.
pME-LifeAct-GFP vector Map
pME-LifeAct-GFP vector Sequence
LOCUS 40924_30500 3342 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pME-LifeAct-GFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3342) AUTHORS Hall TE, Currie PD. TITLE Direct Submission JOURNAL Submitted (27-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia REFERENCE 2 (bases 1 to 3342) TITLE Direct Submission REFERENCE 3 (bases 1 to 3342) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (27-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..3342 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 569..668 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" misc_feature 674..745 /label=LifeAct 5-prime tag /note="LifeAct 5-prime tag" CDS 674..724 /codon_start=1 /product="peptide that binds filamentous actin (Riedl et al., 2008)" /label=Lifeact /note="first 17 amino acids of budding yeast Abp140" /translation="MGVADLIKKFESISKEE" CDS 746..1462 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" protein_bind complement(1467..1566) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(1584..1602) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1607..1623) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1736..2542 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2692..3280 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.