Basic Vector Information
- Vector Name:
- pME-lama4-NS
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8158 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Sztal TE, Sonntag C, Hall TE, Currie PD.
pME-lama4-NS vector Map
pME-lama4-NS vector Sequence
LOCUS 40924_30495 8158 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pME-lama4-NS, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8158) AUTHORS Sztal TE, Sonntag C, Hall TE, Currie PD. TITLE Epistatic dissection of laminin-receptor interactions in dystrophic zebrafish muscle JOURNAL Hum. Mol. Genet. 21 (21), 4718-4731 (2012) PUBMED 22859503 REFERENCE 2 (bases 1 to 8158) AUTHORS Hall TE, Sztal TE, Currie PD. TITLE Direct Submission JOURNAL Submitted (21-JUN-2012) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia REFERENCE 3 (bases 1 to 8158) TITLE Direct Submission REFERENCE 4 (bases 1 to 8158) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Hum. Mol. Genet."; date: "2012"; volume: "21"; issue: "21"; pages: "4718-4731" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-JUN-2012) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8158 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 569..668 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" misc_feature 669..6281 /label=similar to laminin alpha4 chain /note="similar to laminin alpha4 chain" protein_bind complement(6283..6382) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(6400..6418) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(6423..6439) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 6552..7358 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 7508..8096 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.