Basic Vector Information
- Vector Name:
- pME-h2afv-EosFPtd
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4410 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hall TE, Currie PD.
pME-h2afv-EosFPtd vector Map
pME-h2afv-EosFPtd vector Sequence
LOCUS V004792 4410 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004792 VERSION V004792 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4410) AUTHORS Hall TE, Currie PD. TITLE Direct Submission JOURNAL Submitted (27-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia REFERENCE 2 (bases 1 to 4410) TITLE Direct Submission REFERENCE 3 (bases 1 to 4410) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (27-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia" SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4410 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" protein_bind 569..667 /label="attL1" /note="recombination site for the Gateway(R) LR reaction" CDS 674..1057 /gene="H2AZ2" /label="Histone H2A.V" /note="Histone H2A.V from Bos taurus. Accession#: Q32LA7" CDS 1067..1090 /label="FLAG" /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 1130..1804 /label="EosFP" /note="green-to-red photoswitchable fluorescent protein (Wiedenmann et al., 2004)" CDS 1847..2524 /codon_start=1 /product="green-to-red photoswitchable fluorescent protein (Wiedenmann et al., 2004)" /label="EosFP" /translation="SAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKE GGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARN DITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIRMALLLE GNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDN ARR" protein_bind complement(2535..2634) /label="attL2" /note="recombination site for the Gateway(R) LR reaction" promoter complement(2652..2670) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2675..2691) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" CDS 2804..3610 /label="KanR" /note="aminoglycoside phosphotransferase" rep_origin 3760..4348 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.